DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and trx1

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_593852.1 Gene:trx1 / 2542084 PomBaseID:SPAC7D4.07c Length:103 Species:Schizosaccharomyces pombe


Alignment Length:101 Identity:34/101 - (33%)
Similarity:59/101 - (58%) Gaps:3/101 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAKVDIDEHSELALD 100
            :|..:.:| |.:....:.|:||||||||.|||.:.|:.|......:.: ...|||:|:.||:|.:
pombe     4 QVSDSSEF-KSIVCQDKLVVVDFFATWCGPCKAIAPKFEQFSNTYSDA-TFIKVDVDQLSEIAAE 66

  Fly   101 YDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWVAA 136
            ..|.|:|...:.:||::::.:|| .:..|:.|.:.|
pombe    67 AGVHAMPSFFLYKNGEKIEEIVG-ANPAKLEASIKA 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 33/98 (34%)
trx1NP_593852.1 TRX_family 9..100 CDD:239245 32/93 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.