DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and trx-4

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_491142.1 Gene:trx-4 / 189905 WormBaseID:WBGene00021548 Length:107 Species:Caenorhabditis elegans


Alignment Length:115 Identity:33/115 - (28%)
Similarity:63/115 - (54%) Gaps:8/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAKV 89
            :|::....:.||...||   ||.    ||||:.|.|:||.||:::.||:|.:..|....:.:.|:
 Worm     1 MSIAIKDDDEFKTIFAE---KKT----QPVILFFTASWCGPCQMIKPRVEELAAEHKDRLSILKI 58

  Fly    90 DIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWVAAAVK 139
            |:||...:..:|::.::|..:::.:|.:..:..| .:..|....|.||::
 Worm    59 DVDECDGVGEEYEINSMPTFLLIVDGIKKDQFSG-ANNTKFEEMVKAALQ 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 29/98 (30%)
trx-4NP_491142.1 TRX_family 9..103 CDD:239245 29/101 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1127
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.