DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and trx-2

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001256207.1 Gene:trx-2 / 179434 WormBaseID:WBGene00007099 Length:145 Species:Caenorhabditis elegans


Alignment Length:110 Identity:46/110 - (41%)
Similarity:70/110 - (63%) Gaps:3/110 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QIRMLSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSIK 85
            |:|..|..|   .:|.:.|.|||.:||..|..||||||.|.||.||:.|.||:|..|..:.||:.
 Worm    29 QLRHFSHGA---SVFDIDSVEDFTEKVIQSSVPVIVDFHAEWCGPCQALGPRLEEKVNGRQGSVL 90

  Fly    86 LAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKI 130
            |||:::|...|||:||.::|||.:...:||:::....|:.|::::
 Worm    91 LAKINVDHAGELAMDYGISAVPTVFAFKNGEKISGFSGVLDDEQL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 41/92 (45%)
trx-2NP_001256207.1 TRX_family 46..140 CDD:239245 40/90 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165211
Domainoid 1 1.000 95 1.000 Domainoid score I4653
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40849
Inparanoid 1 1.050 102 1.000 Inparanoid score I3551
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48905
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - otm14374
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - LDO PTHR43601
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X935
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.