DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and C14B9.2

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_498775.2 Gene:C14B9.2 / 176147 WormBaseID:WBGene00015752 Length:618 Species:Caenorhabditis elegans


Alignment Length:90 Identity:29/90 - (32%)
Similarity:49/90 - (54%) Gaps:5/90 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESIVGE---QAGSIKLAKVDI 91
            |.:|:..: :.|:||..:.|::. |:|:|:|.||..||.|.|..|....:   |...:||.|||.
 Worm   145 PPEEVVTL-TTENFDDFISNNEL-VLVEFYAPWCGHCKKLAPEYEKAAQKLKAQGSKVKLGKVDA 207

  Fly    92 DEHSELALDYDVAAVPVLVVLQNGK 116
            ....:|...|.|:..|.:.:::||:
 Worm   208 TIEKDLGTKYGVSGYPTMKIIRNGR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 27/81 (33%)
C14B9.2NP_498775.2 pdi_dom 41..138 CDD:273454
ER_PDI_fam 147..616 CDD:273457 28/88 (32%)
pdi_dom 152..253 CDD:273454 27/83 (33%)
Thioredoxin_like 256..361 CDD:294274
PDI_b'_ERp72_ERp57 366..476 CDD:239371
PDI_a_PDI_a'_C 500..604 CDD:239293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.