DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and png-1

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_492913.1 Gene:png-1 / 173028 WormBaseID:WBGene00010160 Length:606 Species:Caenorhabditis elegans


Alignment Length:81 Identity:26/81 - (32%)
Similarity:47/81 - (58%) Gaps:4/81 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEV 118
            :|:||||.||.||::::|..|....|. |:....||:.|...::...|:::|:|..:.|:|.::|
 Worm    25 IIIDFFANWCGPCRMISPIFEQFSAEY-GNATFLKVNCDVARDIVQRYNISAMPTFIFLKNRQQV 88

  Fly   119 QRMVGLQDE---DKIR 131
            ..:.|...:   :|||
 Worm    89 DMVRGANQQAIAEKIR 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 26/81 (32%)
png-1NP_492913.1 TRX_family 20..103 CDD:239245 23/78 (29%)
Transglut_core 204..296 CDD:280085
YebA <235..312 CDD:224224
PAW 407..604 CDD:299187
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.