DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and LOC1275014

DIOPT Version :10

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:XP_314234.2 Gene:LOC1275014 / 1275014 VectorBaseID:AGAMI1_001868 Length:136 Species:Anopheles gambiae


Alignment Length:32 Identity:6/32 - (18%)
Similarity:17/32 - (53%) Gaps:0/32 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DVSAYLRRASGAFIELKSIHREIKSKETKLSS 67
            ::||.:........|:..|||::.::...:::
Mosquito   337 EISAQVAAGMAYLEEMNFIHRDLAARNILINN 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 CnoX 39..138 CDD:442352 5/29 (17%)
LOC1275014XP_314234.2 CnoX 36..130 CDD:442352
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.