powered by:
Protein Alignment CG8993 and LOC100497910
DIOPT Version :9
Sequence 1: | NP_647716.1 |
Gene: | CG8993 / 38301 |
FlyBaseID: | FBgn0035334 |
Length: | 142 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031746215.1 |
Gene: | LOC100497910 / 100497910 |
-ID: | - |
Length: | 112 |
Species: | Xenopus tropicalis |
Alignment Length: | 73 |
Identity: | 21/73 - (28%) |
Similarity: | 33/73 - (45%) |
Gaps: | 10/73 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 FKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAKVDIDEHSELAL 99
|.:|.| .::.|:|...:..|..|||.||.:||::.:....:.| |.|:.|..|...
Frog 12 FALQEA---------GEKLVLVALSSRRCGHCKLTTPYLESLIPKMPDVVFL-KADVSESQEFME 66
Fly 100 DYDVAAVP 107
.:.|..||
Frog 67 LFQVKGVP 74
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1482186at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.