DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and AT2G45530

DIOPT Version :10

Sequence 1:NP_647715.2 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_566045.1 Gene:AT2G45530 / 819161 AraportID:AT2G45530 Length:240 Species:Arabidopsis thaliana


Alignment Length:52 Identity:15/52 - (28%)
Similarity:24/52 - (46%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SQGDICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELC 56
            |..:.|||| .:.:.:..:...|.|.|.:...|:.|:..|.|......||:|
plant    69 SSHEQCRVC-LQDKEEVLIELGCQCRGGLAKAHRSCIDAWFRTKGSNQCEIC 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_647715.2 SSM4 9..>206 CDD:227510 14/48 (29%)
RING_CH-C4HC3_MARCH6 9..58 CDD:438362 14/48 (29%)
SSM4 <359..>554 CDD:227510
AT2G45530NP_566045.1 RINGv 73..120 CDD:128983 14/48 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.