DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and Marchf1

DIOPT Version :10

Sequence 1:NP_647715.2 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001390802.1 Gene:Marchf1 / 72925 MGIID:1920175 Length:540 Species:Mus musculus


Alignment Length:68 Identity:28/68 - (41%)
Similarity:40/68 - (58%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DDLSQG-DICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFSFQPI 65
            ||.|.. ::||:|.||...:.||..||.|||:::::||.||..|::.|....||||.|.|..:..
Mouse   322 DDGSDNFEVCRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIKSSDTRCCELCKYDFIMETK 386

  Fly    66 YAP 68
            ..|
Mouse   387 LKP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_647715.2 SSM4 9..>206 CDD:227510 25/60 (42%)
RING_CH-C4HC3_MARCH6 9..58 CDD:438362 22/48 (46%)
SSM4 <359..>554 CDD:227510
Marchf1NP_001390802.1 Responsible for low stability 1..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..69
RING_Ubox 329..394 CDD:473075 25/61 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.