DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and Marchf4

DIOPT Version :10

Sequence 1:NP_647715.2 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001414713.1 Gene:Marchf4 / 367295 RGDID:1590797 Length:409 Species:Rattus norvegicus


Alignment Length:128 Identity:32/128 - (25%)
Similarity:56/128 - (43%) Gaps:14/128 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDDLSQGDICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFSFQPI 65
            :|...:..:||:| .:......|..||.|.||:|..||.||:.|:.......||||.|.:....|
  Rat   153 LDSGMRTPLCRIC-FQGPEQGELLSPCRCDGSVKCTHQPCLIKWISERGCWSCELCYYKYHVIAI 216

  Fly    66 YAPDMPRVLPIKDVLVGL-------MSAVLEGARCWLHYTLVGLAWFGVVPLSAYRTYRYLFR 121
            ...:     |::...:.|       ::|.:.|: .:|..::..|.|....|.:.::....||:
  Rat   217 STKN-----PLQWQAISLTVIEKVQIAAAILGS-LFLIASISWLIWSTFSPSAKWQRQDLLFQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_647715.2 SSM4 9..>206 CDD:227510 31/120 (26%)
RING_CH-C4HC3_MARCH6 9..58 CDD:438362 19/48 (40%)
SSM4 <359..>554 CDD:227510
Marchf4NP_001414713.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.