DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and Marchf10

DIOPT Version :10

Sequence 1:NP_647715.2 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:XP_063125263.1 Gene:Marchf10 / 303596 RGDID:1311692 Length:797 Species:Rattus norvegicus


Alignment Length:64 Identity:23/64 - (35%)
Similarity:36/64 - (56%) Gaps:9/64 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DDLSQGDICRVCR-CEAQPDRPLFYPCICTGSIKYIHQDCLMLWMR--------YSHKEYCELC 56
            |...:||:||:|: ....|..||..||.|.||::::||:||..|::        .|..:.||:|
  Rat   633 DSEEEGDLCRICQIAGGSPANPLLEPCGCVGSLQFVHQECLKKWLKVKITSGADLSTVKTCEMC 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_647715.2 SSM4 9..>206 CDD:227510 20/57 (35%)
RING_CH-C4HC3_MARCH6 9..58 CDD:438362 20/57 (35%)
SSM4 <359..>554 CDD:227510
Marchf10XP_063125263.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.