DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsR1 and GPR142

DIOPT Version :9

Sequence 1:NP_001261324.1 Gene:MsR1 / 38298 FlyBaseID:FBgn0035331 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_861455.1 Gene:GPR142 / 350383 HGNCID:20088 Length:462 Species:Homo sapiens


Alignment Length:424 Identity:83/424 - (19%)
Similarity:148/424 - (34%) Gaps:146/424 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LGTIANTLNIIVLTR--REMRSPTNAILTGLAVAD--LAVMLEYIPYTIHDYILTDSLPREEKLS 98
            ||...:.|..:.|.|  ...|.|:...|..|..:|  :.|::.:..:.:...:|...:|:     
Human   169 LGLPVSLLTAVALARLATRTRRPSYYYLLALTASDIIIQVVIVFAGFLLQGAVLARQVPQ----- 228

  Fly    99 YSWACFIKFHSIFAQVLHTISIWLTVTLAVWRYIAVGYPQKNRVWCGMRTTIITITTAYVVCVLV 163
                ..::..:|.....:..|:|:.:.|.|.||.|:.:|..:|.     .:....|...:..|| 
Human   229 ----AVVRTANILEFAANHASVWIAILLTVDRYTALCHPLHHRA-----ASSPGRTRRAIAAVL- 283

  Fly   164 VSPSLYLITAITEYVDQLDMNGKVINSIPMTQYVIDYRNELLSARTAALNATPTSAPLNETV-WL 227
               |..|:|.|..|                  :.:|...:..|.||           |:|.: |.
Human   284 ---SAALLTGIPFY------------------WWLDMWRDTDSPRT-----------LDEVLKWA 316

  Fly   228 NASTLLTSTTTAAPPTPSPVVRNVTVYRLYHSDLALHNASLQNATFLIYSVVIKLIPCIALTILS 292
            :.                     :|||                           .|||....:.:
Human   317 HC---------------------LTVY---------------------------FIPCGVFLVTN 333

  Fly   293 VRLILALLEAKRRRKKLTSKPATPGASNGTKSPANGKAADRPRKNSKTLEKEKQTDRTTRMLLAV 357
                .|::...|||                     |::..:||           ..::|.:||.:
Human   334 ----SAIIHRLRRR---------------------GRSGLQPR-----------VGKSTAILLGI 362

  Fly   358 LLLFLITEFPQGIMGLLNAVLGDVFY-LQCYLRLSDLMDILALINSSINFILYCSMSKQFRTTFT 421
            ..||.:...|:..:.|.:..:..|.. .:.:|.| |:.:::|:::::.||.|||.:||.||.|  
Human   363 TTLFTLLWAPRVFVMLYHMYVAPVHRDWRVHLAL-DVANMVAMLHTAANFGLYCFVSKTFRAT-- 424

  Fly   422 LLFRPKFLDKWLPVAQDEMAAARAERSAVAPVLE 455
              .|....|.:||..    .|::.|..|..||:|
Human   425 --VRQVIHDAYLPCT----LASQPEGMAAKPVME 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsR1NP_001261324.1 7tm_4 30..427 CDD:304433 74/394 (19%)
GPR142NP_861455.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..123
7tm_1 176..414 CDD:278431 63/369 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4901
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X861
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.