DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsR1 and Gpr139

DIOPT Version :9

Sequence 1:NP_001261324.1 Gene:MsR1 / 38298 FlyBaseID:FBgn0035331 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001019412.1 Gene:Gpr139 / 293545 RGDID:1311729 Length:345 Species:Rattus norvegicus


Alignment Length:409 Identity:100/409 - (24%)
Similarity:155/409 - (37%) Gaps:148/409 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YVSLVVCILGTIANTLNIIVLTR---REMRSPTNAILTGLAVADLAVM--LEYIPYTIHDYILTD 89
            |.|.::| ||..||.|.:|:|::   |..:|..|.:| .||.||:.|:  :.::.:.:.|:|||.
  Rat    24 YYSFLLC-LGLPANILTVIILSQLVARRQKSSYNYLL-ALAAADILVLFFIVFVDFLLEDFILTM 86

  Fly    90 SLPR-EEKLSYSWACFIKFHSIFAQVLHTISIWLTVTLAVWRYIAVGYPQKNRVWCGMRTTIITI 153
            .:|. .:|:..    .::|.||     || |||:||.|.|.|||||.:|.|.........|...|
  Rat    87 QMPPIPDKIIE----VLEFSSI-----HT-SIWITVPLTVDRYIAVCHPLKYHTVSYPARTRKVI 141

  Fly   154 TTAYVVCVLVVSPSLYLITAITEYVDQLDMNGKVINSIPMTQYVIDYRNELLSARTAALNATPTS 218
            .:.|:.|.|...|..:.....||                  .|:....:.:|             
  Rat   142 LSVYITCFLTSIPYYWWPNIWTE------------------DYISTSMHHVL------------- 175

  Fly   219 APLNETVWLNASTLLTSTTTAAPPTPSPVVRNVTVYRLYHSDLALHNASLQNATFLIYSVVIKLI 283
                  ||::.                                           |.:|     |:
  Rat   176 ------VWIHC-------------------------------------------FTVY-----LV 186

  Fly   284 PCIALTILSVRLILALLEAKRRRKKLTSKPATPGASNGTKSPANGKAADRPRKNSKTLEKEKQTD 348
            ||....||:     :::..|.|||   |.....|.|.|                           
  Rat   187 PCSIFFILN-----SIIVYKLRRK---SNFRLRGYSTG--------------------------- 216

  Fly   349 RTTRMLLAVLLLFLITEFPQGIM---GLLNAVLGDVFYLQCYLRLSDLMDILALINSSINFILYC 410
            :||.:|..:..:|.....|:.||   .|..|.:.:.:.:...|   |:.::|||:|::|||.|||
  Rat   217 KTTAILFTITSIFATLWAPRIIMILYHLYGAPIQNPWLVHIML---DVANMLALLNTAINFFLYC 278

  Fly   411 SMSKQFRT----TFTLLFR 425
            .:||:|||    |...||:
  Rat   279 FISKRFRTMAAATLKALFK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsR1NP_001261324.1 7tm_4 30..427 CDD:304433 100/409 (24%)
Gpr139NP_001019412.1 7tmA_GPR139 19..288 CDD:320585 97/398 (24%)
TM helix 1 21..45 CDD:320585 10/21 (48%)
TM helix 2 55..77 CDD:320585 7/22 (32%)
TM helix 3 94..116 CDD:320585 12/31 (39%)
TM helix 4 139..155 CDD:320585 4/15 (27%)
TM helix 5 173..196 CDD:320585 10/94 (11%)
TM helix 6 219..241 CDD:320585 6/21 (29%)
TM helix 7 256..281 CDD:320585 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4851
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343117at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X861
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.