DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsR1 and srw-54

DIOPT Version :9

Sequence 1:NP_001261324.1 Gene:MsR1 / 38298 FlyBaseID:FBgn0035331 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_507202.1 Gene:srw-54 / 189573 WormBaseID:WBGene00005801 Length:351 Species:Caenorhabditis elegans


Alignment Length:405 Identity:84/405 - (20%)
Similarity:146/405 - (36%) Gaps:130/405 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YVSLVVCILGTIANTLNIIVLTRREMRSPT-NAILTGLAVADLAVMLEYIPYTIHDYILTDSLPR 93
            |.:..:.::|.|||..::|||.|:.||:.| |..:.|:|:.:...|:.|:...|..|     ..:
 Worm    39 YFNFSISVVGVIANIFHLIVLGRKSMRALTVNTFMMGIAICEFVRMMCYVIMRIPKY-----YRK 98

  Fly    94 EEKL----------SYSWACFIKFHSIFAQVLHTISIWLTVTLAVWRYIAVGYPQKNRVWCGMRT 148
            .:|.          ||...|.:...||....:....|.:.|.:||.|.:::.||..:::      
 Worm    99 YQKFKFGRFCVPPDSYLTICIVNNSSILFNSIQDPLISIAVAMAVLRTVSLKYPMSSKI------ 157

  Fly   149 TIITITTAYVVCVLVVSPSLYLITAITEYVDQLDMNGKVINSIPMTQYVIDYRNELLSARTAALN 213
                               |.:|..||               ||.  :.:|:..           
 Worm   158 -------------------LLIIRGIT---------------IPF--WALDFSQ----------- 175

  Fly   214 ATPTSAPLNETVWLNASTLLTSTTTAAPPTPSP-VVRNVTVYRLYHSDLALHNASLQNATF--LI 275
                                |..|..:.|...| ..::....|.|.|.    ..||||..|  ||
 Worm   176 --------------------TQVTVESDPWRLPDDCKHFAEGRFYFST----TTSLQNQGFVLLI 216

  Fly   276 YSVVIKLIPCIALTILSVRLILALLEAKRRRKKLTSKPATPGASNGTKSPANGKAADRPRKNSKT 340
            ..::.|||..:.|.|.:    |.|:...:.|.|::|..::  |||                    
 Worm   217 QGILFKLILSLVLPIAT----LILIHDIKMRNKVSSVGSS--ASN-------------------- 255

  Fly   341 LEKEKQTDRTTRMLLAVLLLFLITEFPQGIMGLLN-AVLGDVFYLQCYLRLSDLMDILALINSSI 404
                   ||:|.:::.:.:.|:|...|||::.|:. ....|...:.....|::....:.|.|.:|
 Worm   256 -------DRSTNLVVFMTISFIIALAPQGVLYLIKFTYKNDEGVVSTIETLNNFHAFVPLANGTI 313

  Fly   405 NFILYCSMSKQFRTT 419
            :.|:...:|..:|.|
 Worm   314 HIIINFFISSMYRRT 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsR1NP_001261324.1 7tm_4 30..427 CDD:304433 84/405 (21%)
srw-54NP_507202.1 7TM_GPCR_Srw 39..336 CDD:370978 84/405 (21%)
TM helix 1 39..62 CDD:341315 8/22 (36%)
TM helix 2 69..94 CDD:341315 6/24 (25%)
TM helix 3 120..150 CDD:341315 7/29 (24%)
TM helix 5 201..235 CDD:341315 13/41 (32%)
TM helix 6 253..283 CDD:341315 12/56 (21%)
TM helix 7 294..322 CDD:341315 5/27 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.