DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsR1 and srw-39

DIOPT Version :9

Sequence 1:NP_001261324.1 Gene:MsR1 / 38298 FlyBaseID:FBgn0035331 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001343561.1 Gene:srw-39 / 184662 WormBaseID:WBGene00005786 Length:266 Species:Caenorhabditis elegans


Alignment Length:319 Identity:61/319 - (19%)
Similarity:123/319 - (38%) Gaps:93/319 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GSGMDNFHTSYKNMHGYVSL---VVCILGTIANTLNIIVLTRREMRS-PTNAILTGLAVAD---- 70
            |.....|.:...::..|:.|   ::..:|...:..:..:|||..||. .||..|.|:.|..    
 Worm    17 GDAWLKFSSWINSISAYLYLTDFIISFIGIFPSLFHFWILTRTYMRHLTTNLFLIGITVCGIIHI 81

  Fly    71 LAVMLEYIPYTIHDYILTDSLPREEKLSYSWACFIK-----FHSIFAQVLHTISIWLTVTLAVWR 130
            :..::|:.| .::||.|:..:|.|   .:.:|.:.|     :.|:...|:..:..:.||.:|:.|
 Worm    82 ICNIIEFFP-MLYDYYLSFKVPSE---CFPFAPYSKIVSNYYSSMTNAVVTGMLTYFTVAMAIIR 142

  Fly   131 YIAVGYPQKNRVWCGMRTTI-----ITITTAYVVCVLVVSPSLYLITAITE---YVDQLDMNGKV 187
            ::.|.:|..:    ||:..|     :.|....::.:|.:..:....|.|.|   :|...:.:|  
 Worm   143 FLVVKFPLAS----GMQRLIYSKSGLKILLPIIILILPLWIAEISSTNIVETGIWVPGPNCDG-- 201

  Fly   188 INSIPMTQYVIDYRNELLSARTAALNATPTSAPLNETVWLNASTLLTSTTTAAPPTPSPVVRNVT 252
                    :..:|..::.:..|:      .:..::|..|:                         
 Worm   202 --------FAENYTEKMYTVETS------ITFGIDEFYWI------------------------- 227

  Fly   253 VYRLYHSDLALHNASLQNATFLIYSVVIKLIPCIALTILSVRLILALLEAKRRRKKLTS 311
                               .:.||:|:.:.||.|.|.|.:|.||:.|    ::.||.|:
 Worm   228 -------------------VYYIYAVIFQFIPSILLPISTVLLIIEL----KKNKKTTT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsR1NP_001261324.1 7tm_4 30..427 CDD:304433 59/303 (19%)
srw-39NP_001343561.1 7tm_GPCRs 39..>255 CDD:391938 53/283 (19%)
TM helix 2 66..94 CDD:341315 7/28 (25%)
TM helix 3 112..147 CDD:341315 7/34 (21%)
TM helix 4 162..186 CDD:341315 2/23 (9%)
TM helix 5 225..250 CDD:341315 9/68 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.