DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsR1 and egl-6

DIOPT Version :9

Sequence 1:NP_001261324.1 Gene:MsR1 / 38298 FlyBaseID:FBgn0035331 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001257033.1 Gene:egl-6 / 183513 WormBaseID:WBGene00001175 Length:395 Species:Caenorhabditis elegans


Alignment Length:422 Identity:118/422 - (27%)
Similarity:189/422 - (44%) Gaps:108/422 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NFHTSYKNMHGYVSLVVCILGTIANTLNIIVLTRREMRSPTNAILTGLAVADLAVMLEYIPYTIH 83
            :|...|..:|..:|:.:||.|..:|..|||||||:.||:|.|.:||||::|...:...|..|.:.
 Worm    27 SFLQYYDEIHIPLSISICIFGAASNVFNIIVLTRKRMRTPINILLTGLSIAQWLLATNYFLYLLL 91

  Fly    84 DYILTDSLPREEKLSYSWA-CFIK---FHSIFAQVLHTISIWLTVTLAVWRYIAVGYP-QKNRVW 143
            :|.      |.:.:...|: .|.:   |:.....|.|||:...|:.:||:||.|:.:| |.||..
 Worm    92 EYY------RYQCVQLLWSEAFTRYRFFNVNLNTVFHTIAFTTTIVVAVFRYCALKFPIQANRFI 150

  Fly   144 CGMRTTIITITTAYVVCVLVVSPSLYLITAI-------TEYVDQLDMNGKVINSIPMTQYVIDYR 201
            ...:..|......::: :.::|..|:.|:.:       ..|..|.:|.|.:        |.:.|:
 Worm   151 YKCQPAIAANVIIWII-IPIISLPLFFISEVKIVARDHVAYDLQCEMEGPL--------YDLSYQ 206

  Fly   202 NELLSARTAALNATPTSAPLNETVWLNASTLLTSTTTAAPPTPSPVVRNVTVYRLYHSDLALHNA 266
            .                                          ||:                   
 Worm   207 E------------------------------------------SPL------------------- 210

  Fly   267 SLQNATFLIYSVVIKLIPCIALTILSVRLILALLEAKRRRKKLTSKPATPGASNGTKS--PANGK 329
             |.:|.|..:.:|.||:|.:.|:||.:.||.:|...:||||   :...|.||:..|.|  .|..|
 Worm   211 -LVSAVFWAFGIVFKLLPSLILSILLIALIRSLKSVERRRK---NWKRTQGANICTNSERKAKRK 271

  Fly   330 AADRPRKNSKTLEKEKQTDRTTRMLLAVLLLFLITEFPQGIMGLLNAVLGDVFYLQCYLRLSDLM 394
            ...||              ||||||:.:|||.::.|.|.||:.|..|:.|:.|..:.|..:.:||
 Worm   272 LTTRP--------------RTTRMLVIILLLCVMVELPMGILNLCVAIYGEEFGNRYYDPVGNLM 322

  Fly   395 DILALINSSINFILYCSMSKQFRTTFTLLFRP 426
            ::|.|:.||::|:|||:||.::.:||..||.|
 Worm   323 EMLTLLYSSVSFVLYCTMSNEYLSTFRALFFP 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsR1NP_001261324.1 7tm_4 30..427 CDD:304433 115/411 (28%)
egl-6NP_001257033.1 7tmA_FMRFamide_R-like 35..348 CDD:320109 111/406 (27%)
TM helix 1 35..61 CDD:320109 12/25 (48%)
TM helix 2 67..92 CDD:320109 8/24 (33%)
TM helix 3 111..141 CDD:320109 11/29 (38%)
TM helix 4 154..174 CDD:320109 2/20 (10%)
TM helix 5 212..237 CDD:320109 9/24 (38%)
TM helix 6 273..303 CDD:320109 16/43 (37%)
TM helix 7 316..341 CDD:320109 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28978
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46273
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.