DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsR1 and GPR139

DIOPT Version :9

Sequence 1:NP_001261324.1 Gene:MsR1 / 38298 FlyBaseID:FBgn0035331 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001002911.1 Gene:GPR139 / 124274 HGNCID:19995 Length:353 Species:Homo sapiens


Alignment Length:412 Identity:100/412 - (24%)
Similarity:157/412 - (38%) Gaps:138/412 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YVSLVVCILGTIANTLNIIVLTR---REMRSPTNAILTGLAVADLAVM--LEYIPYTIHDYILTD 89
            |.||::| ||..||.|.:|:|::   |..:|..|.:| .||.||:.|:  :.::.:.:.|:||..
Human    32 YYSLLLC-LGLPANILTVIILSQLVARRQKSSYNYLL-ALAAADILVLFFIVFVDFLLEDFILNM 94

  Fly    90 SLPR-EEKLSYSWACFIKFHSIFAQVLHTISIWLTVTLAVWRYIAVGYPQKNRVWCGMRTTIITI 153
            .:|: .:|:..    .::|.||     || |||:||.|.:.|||||.:|.|.........|...|
Human    95 QMPQVPDKIIE----VLEFSSI-----HT-SIWITVPLTIDRYIAVCHPLKYHTVSYPARTRKVI 149

  Fly   154 TTAYVVCVLVVSPSLYLITAITEYVDQLDMNGKVINSIPMTQYVIDYRNELLSARTAALNATPTS 218
            .:.|:.|.|...|..:.....||                      ||                  
Human   150 VSVYITCFLTSIPYYWWPNIWTE----------------------DY------------------ 174

  Fly   219 APLNETVWLNASTLLTSTTTAAPPTPSPVVRNVTVYRLYHSDLALHNASLQNATFLIYSVVIKLI 283
                           .||:                  ::|..:.:|       .|.:|     |:
Human   175 ---------------ISTS------------------VHHVLIWIH-------CFTVY-----LV 194

  Fly   284 PCIALTILSVRLILALLEAKRRRKKLTSKPATPGASNGTKSPANGKAADRPRKNSKTLEKEKQTD 348
            ||....||:     :::..|.|||   |.....|.|.|                           
Human   195 PCSIFFILN-----SIIVYKLRRK---SNFRLRGYSTG--------------------------- 224

  Fly   349 RTTRMLLAVLLLFLITEFPQGIMGLLNAVLGDVFYLQCYLRLSDLMDILALINSSINFILYCSMS 413
            :||.:|..:..:|.....|:.||.|.:.....:........:||:.::|||:|::|||.|||.:|
Human   225 KTTAILFTITSIFATLWAPRIIMILYHLYGAPIQNRWLVHIMSDIANMLALLNTAINFFLYCFIS 289

  Fly   414 KQFRTTFTLLFRPKFLDKWLPV 435
            |:|||......:..|..:..||
Human   290 KRFRTMAAATLKAFFKCQKQPV 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsR1NP_001261324.1 7tm_4 30..427 CDD:304433 97/402 (24%)
GPR139NP_001002911.1 7tmA_GPR139 27..296 CDD:320585 97/395 (25%)
TM helix 1 29..53 CDD:320585 11/21 (52%)
TM helix 2 63..85 CDD:320585 7/22 (32%)
TM helix 3 102..124 CDD:320585 12/31 (39%)
TM helix 4 147..163 CDD:320585 4/15 (27%)
TM helix 5 181..204 CDD:320585 9/39 (23%)
TM helix 6 227..249 CDD:320585 6/21 (29%)
TM helix 7 264..289 CDD:320585 12/24 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4901
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343117at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X861
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.