DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsR2 and CNMaR

DIOPT Version :9

Sequence 1:NP_001261323.1 Gene:MsR2 / 38296 FlyBaseID:FBgn0264002 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001027122.2 Gene:CNMaR / 39127 FlyBaseID:FBgn0053696 Length:480 Species:Drosophila melanogaster


Alignment Length:434 Identity:89/434 - (20%)
Similarity:167/434 - (38%) Gaps:88/434 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YFHGYFSLIVCILGTIANTLNIIVLTRREMRSPTNAI-LTGLAVADLAVMLEYIPYTVHDYILSV 87
            :.|.|:..::|..|:|.|.|::.|..|.::|..:::. |..|||:|...:.......::  .|:|
  Fly    60 FVHQYYIPVLCCTGSIGNILSVFVFFRTKLRKLSSSFYLAALAVSDTCFLAGLFAQWLN--FLNV 122

  Fly    88 RLPREEQLSYSWACFIKFHSVFPQVLHTISIWLTVTLAVWRYIAVSYPQRNRIWCGMRTTLITIA 152
            .:       |:...|.:|.:.|..:....|:|..|...|.|:|||.||.:.:..|.:|...|.:.
  Fly   123 DI-------YNQNYFCQFFTFFSYLASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVRRAKIVLF 180

  Fly   153 TAYVVCVLVVSPWLYLVTAIAKFLETLDANGKTIASVPLSQYILDYNRQDEVTMQVMSSTTPDVS 217
            ...:|..|...|  |:|.|...|:..|:..            |.|.|.:.:..:.:.:.....|.
  Fly   181 CLTLVGCLHCLP--YIVIAKPVFMPKLNTT------------ICDLNSEYKEQLALFNYWDTIVV 231

  Fly   218 WAIPSDSANGTAVSLLSLTTVIPLTTLSTGVTT-SSSLGERNVTVYKLYHSALALRDRQFRNATF 281
            :|:|             .||:..|.| .||.|. ..:...|.:|::|:.....::......::..
  Fly   232 YAVP-------------FTTIAVLNT-CTGCTVWKFATVRRTLTMHKMKPQTNSMPSNSSNSSGG 282

  Fly   282 LIYSVLIKLIPCFALTILSVRLIGALLEAKRRRKILACHAANDMQPIVNGKVVIPTQPKS----- 341
            .            :..:.|.||..:|    :|:|....|.:. ...:.|.:.....|.:.     
  Fly   283 A------------SSAVASYRLSASL----KRQKSTGTHPSG-QHNVANRQTDDQEQQQQSQQHQ 330

  Fly   342 -------CKLLEKEKQTD-------RTTRMLLAVLLLFLVTEFPQGIMGLLNVLLGDAFF----- 387
                   |::.:|..:..       :.|:|||.|..:|:....|..::.:      :|::     
  Fly   331 INNCQHHCEITQKPARRKVQNSSQLKVTKMLLIVSTVFVCLNLPSCLLRI------EAYWETESA 389

  Fly   388 --LQCYLKLSDLMDILALINSSINFILYCSMSRQFRSTFALLFR 429
              ....:.|..:.....:.|..|||:|||...:.||.....:||
  Fly   390 RNQNSTIALQYIFHAFFITNFGINFVLYCVSGQNFRKAVLSIFR 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsR2NP_001261323.1 7tm_4 28..429 CDD:304433 86/428 (20%)
CNMaRNP_001027122.2 7tm_4 73..>262 CDD:304433 53/225 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467307
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.