DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsR2 and CG15614

DIOPT Version :9

Sequence 1:NP_001261323.1 Gene:MsR2 / 38296 FlyBaseID:FBgn0264002 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_611168.2 Gene:CG15614 / 36899 FlyBaseID:FBgn0034168 Length:469 Species:Drosophila melanogaster


Alignment Length:283 Identity:56/283 - (19%)
Similarity:94/283 - (33%) Gaps:87/283 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 VTMQVMSST---------TPDVSWAIP----SDSANGTAVSLLSLTTVIPLT------------- 242
            :||..:|.:         |.|..|..|    |.......::.|||...|.|:             
  Fly    91 ITMTALSRSYFYSSPTWITYDYQWQTPLFGISTGGANLILACLSLDRFIYLSCFKRNNGAPRFCR 155

  Fly   243 --------TLSTGVTTSSSLGERNVTVYKLYHSALALRDRQFRNATFLIYS-----------VLI 288
                    .::.|:         ::.|...|.....:.|....:.|...|:           .|:
  Fly   156 RKVARCIIVVAIGI---------SIVVNMPYFFVFYVSDSGTCHVTEFYYTNFYKVQNWFTFALL 211

  Fly   289 KLIPCFALTILSVRLIGALLEAKRR--RKILACHAANDMQPIVNGKVVIPTQPKSCKLLEKEKQT 351
            .|:|...|.|.:    ||::.|.|:  ::...|.|.|   |..|.:..........||       
  Fly   212 ALLPAIFLVIGN----GAIIIAFRKWTKQSRICQANN---PAANSRTTAKRYQHQMKL------- 262

  Fly   352 DRTTRMLLAVLLLFLVTEFPQGI---MGLLNVLLG-------DAFFLQCYLKLSDLMDILALINS 406
               |..::.|:.|:|..|.|..:   ...||:|.|       |:|..|    |..:...|..:..
  Fly   263 ---TISIVIVITLYLFGELPAHMTSRKSSLNLLFGGDANKVDDSFIEQ----LEVICITLNALQL 320

  Fly   407 SINFILYCSMSRQFRSTFALLFR 429
            |:|.::|..::..|...|.|..:
  Fly   321 SLNIVVYAVINPSFMPEFFLCLK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsR2NP_001261323.1 7tm_4 28..429 CDD:304433 56/281 (20%)
CG15614NP_611168.2 7tm_4 48..>242 CDD:304433 29/163 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467309
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.