DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsR2 and SPR

DIOPT Version :9

Sequence 1:NP_001261323.1 Gene:MsR2 / 38296 FlyBaseID:FBgn0264002 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001368972.1 Gene:SPR / 31463 FlyBaseID:FBgn0029768 Length:512 Species:Drosophila melanogaster


Alignment Length:487 Identity:118/487 - (24%)
Similarity:192/487 - (39%) Gaps:168/487 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TNMSQ---PHYCGTGIDDFHTNYKY-----------------------------FHGYFSLIVCI 35
            ||.||   |.|....:|  :.||:.                             .:||....:.|
  Fly    39 TNESQLEIPDYGNESLD--YPNYQQMVGGPCRMEDNNISYWNLTCDSPLEYAMPLYGYCMPFLLI 101

  Fly    36 LGTIANTLNIIVLTRREMRSPTNAILTGLAVADLAVMLEYIP-----YTVHDYILSVRLPREEQL 95
            :..|:|:|.::||:::.|.:|||.:|.|:|:.|:..::...|     ||..::...:. |....|
  Fly   102 ITIISNSLIVLVLSKKSMATPTNFVLMGMAICDMLTVIFPAPGLWYMYTFGNHYKPLH-PVSMCL 165

  Fly    96 SYSWACFIKFHSVFPQVLHTISIWLTVTLAVWRYIAVSYPQRNRIWCGMRTTLITIATAYVVCVL 160
            :||     .|:.:.|.:.||||:|||:.|||.|||.|.:....|.||.|  ..:...|||:    
  Fly   166 AYS-----IFNEIMPAMCHTISVWLTLALAVQRYIYVCHAPMARTWCTM--PRVRRCTAYI---- 219

  Fly   161 VVSPWLYLVTAIAKFLETLDANGKTIASVPLSQYILDYNRQDEVTMQVMSSTTPDVSWAIPSDSA 225
                      |:..||.            .|.::.      |...|.::      :.|       
  Fly   220 ----------ALLAFLH------------QLPRFF------DRTYMPLV------IEW------- 243

  Fly   226 NGTAVSLLSLTTVIPLTTLSTGVTTSSSLGERNVTVYKLYHSALALRDRQFRNATFLIYSVL-IK 289
            ||:...:..|.|               |:...:.....||::            ::.::.|| :.
  Fly   244 NGSPTEVCHLET---------------SMWVHDYIGVDLYYT------------SYYLFRVLFVH 281

  Fly   290 LIPCFALTILSVRLIGALLEAKRRRKILACHAANDMQPIVNGKVVIPTQPKSCKLLEKEKQTDRT 354
            |:||..|..|::.|..|:.:|:.|||:|                ....:.|.||   |.::|:.|
  Fly   282 LLPCIILVTLNILLFAAMRQAQERRKLL----------------FRENRKKECK---KLRETNCT 327

  Fly   355 TRMLLAVLLLFLVTEFPQGIM----------------GLLNVLLGDAFFLQCYLKLSDLMDILAL 403
            |.||:.|:.:||:.|.|..::                ||.|:         |.:    |.:...:
  Fly   328 TLMLIVVVSVFLLAEIPIAVVTAMHIVSSLIIEFLDYGLANI---------CIM----LTNFFLV 379

  Fly   404 INSSINFILYCSMSRQFRSTFALLFRPRWLDK 435
            .:..|||.:||.||||||.||..:|..|.:.|
  Fly   380 FSYPINFGIYCGMSRQFRETFKEIFLGRLMAK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsR2NP_001261323.1 7tm_4 28..429 CDD:304433 105/422 (25%)
SPRNP_001368972.1 7tmA_FMRFamide_R-like 90..400 CDD:410630 104/421 (25%)
TM helix 1 92..116 CDD:410630 8/23 (35%)
TM helix 2 124..146 CDD:410630 6/21 (29%)
TM helix 3 169..191 CDD:410630 10/21 (48%)
TM helix 4 214..230 CDD:410630 7/41 (17%)
TM helix 5 270..293 CDD:410630 7/34 (21%)
TM helix 6 328..353 CDD:410630 8/24 (33%)
TM helix 7 368..393 CDD:410630 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8429
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.