DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsR2 and srw-119

DIOPT Version :9

Sequence 1:NP_001261323.1 Gene:MsR2 / 38296 FlyBaseID:FBgn0264002 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_503818.1 Gene:srw-119 / 187328 WormBaseID:WBGene00005866 Length:367 Species:Caenorhabditis elegans


Alignment Length:412 Identity:78/412 - (18%)
Similarity:138/412 - (33%) Gaps:128/412 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FSLIVCILGTIANTLNIIVLTRREMR-SPTNAILTGLAVADLAVMLEYIPYTVHD---------- 82
            :|..:.|...:.|.::..:|||:.|| |..|.::..:|:.|:...|:.|......          
 Worm    41 YSSEISISSVLINLIHFFILTRKPMRTSSINILMAAVALYDILTSLKQIELIFEQNSDIFFDCYP 105

  Fly    83 -YILSVRLPR---EEQLSYSWACFIKFHSVFPQVLHTISIWLTVTLAVWRYIAVSYPQRNRIWCG 143
             |...|.|.|   :....||..|               |.|..|::|..|.:.|..|        
 Worm   106 TYTFGVGLRRIILDIAKDYSRRC---------------STWFIVSIAFIRTVMVRNP-------- 147

  Fly   144 MRTTLITIATAYVVCVLVVSPWLYLVTAIAKFLETLDANGKTIASVPLSQYILDYNRQDEVTMQV 208
            :.:|..::.......|::|                    |...||:|:|  :..|.....|..:.
 Worm   148 LNSTYQSLGKPKASVVVIV--------------------GVCAASLPIS--VFKYFENQFVEKEP 190

  Fly   209 MSSTTPDVSWAIPSDSANGTAVSLLSLTTVIPLTTLSTGVTTSSSLGERNVTVYKLYHSALALRD 273
            :...           :.|||..                           .||:.||:.:......
 Worm   191 LYDC-----------AQNGTYY---------------------------YVTMSKLFTANDGFLA 217

  Fly   274 RQFRNATFLIYSVLIKLIPCFALTILSVRLIGALLE-AKRRRKILACHAANDMQPIVNGKVVIPT 337
            :.|.    |..|.:..:|||..|.|:::.||..|.: ||:|..|.:  |.|              
 Worm   218 KYFS----LFNSFVSDIIPCLLLPIVTLLLIMNLWKTAKKRANITS--ATN-------------- 262

  Fly   338 QPKSCKLLEKEKQTDRTTRMLLAVLLLFLVTEFPQGI-MGLLNVLLGDAFFLQCYLKLSDLMDIL 401
                    .|...:...|.::..|.:.|.:.|||.|: :|.|.:...|:...:.......:..:|
 Worm   263 --------HKNNNSTSKTGLVFCVTITFFIVEFPYGLSLGFLWMFDYDSGISRILSFFGFIFSML 319

  Fly   402 ALINSSINFILYCSMSRQFRST 423
            ..:|:..:..:...:|.|:|.:
 Worm   320 ITLNTCTHLFVCLIISSQYRKS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsR2NP_001261323.1 7tm_4 28..429 CDD:304433 78/412 (19%)
srw-119NP_503818.1 7TM_GPCR_Srw 53..349 CDD:370978 76/400 (19%)
TM helix 2 71..93 CDD:320109 5/21 (24%)
TM helix 3 114..138 CDD:320109 7/38 (18%)
TM helix 4 163..179 CDD:320109 7/37 (19%)
TM helix 5 218..241 CDD:320109 8/26 (31%)
TM helix 6 269..295 CDD:320109 7/25 (28%)
TM helix 7 310..335 CDD:320109 2/24 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.