DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsR2 and dmsr-12

DIOPT Version :9

Sequence 1:NP_001261323.1 Gene:MsR2 / 38296 FlyBaseID:FBgn0264002 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001309508.1 Gene:dmsr-12 / 186799 WormBaseID:WBGene00019262 Length:160 Species:Caenorhabditis elegans


Alignment Length:179 Identity:38/179 - (21%)
Similarity:71/179 - (39%) Gaps:39/179 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IDDFHTN--------YKYFHGYFSLIVCILGTIANTLNIIVLTRREM-RSPTNAILTGLAVAD-- 68
            :||:...        |.:|...|:.       .||.:.:.||:.:|| ||..|..:..:||.|  
 Worm     2 VDDYRCKSIPAVSLLYIHFLSCFAF-------FANIMIVKVLSHKEMIRSGVNVTMLLIAVCDFG 59

  Fly    69 --LAVMLEYIPYTVHDYILSVRLPREEQLSYSWACFIKFHSVFPQVLHTISIWLTVTLAVWRYIA 131
              :|.:|:...::..|..:|........:.|..|.          ..|..|::|.|.:|..|..:
 Worm    60 CSIAELLKLFLWSYSDKYISYPTAYGRLVIYYLAA----------AFHASSLYLAVGMAFCRVKS 114

  Fly   132 VSYPQRNR-IWCGMRTTLITIATAYVVCVLVVSPWLYLVTAIAKFLETL 179
            :::..||. :|   ::....:..|..:|..|     :|:|....|:..:
 Worm   115 LNFANRNNDLW---QSPNYAVRVACALCAPV-----FLITTFILFMNVV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsR2NP_001261323.1 7tm_4 28..429 CDD:304433 34/158 (22%)
dmsr-12NP_001309508.1 7tm_GPCRs 13..>157 CDD:391938 36/168 (21%)
TM helix 1 13..39 CDD:341315 7/32 (22%)
TM helix 2 46..71 CDD:341315 6/24 (25%)
TM helix 3 86..116 CDD:341315 8/39 (21%)
TM helix 4 129..149 CDD:341315 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BWNV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.