DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsR2 and srw-143

DIOPT Version :9

Sequence 1:NP_001261323.1 Gene:MsR2 / 38296 FlyBaseID:FBgn0264002 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_503798.3 Gene:srw-143 / 186788 WormBaseID:WBGene00005890 Length:368 Species:Caenorhabditis elegans


Alignment Length:428 Identity:86/428 - (20%)
Similarity:157/428 - (36%) Gaps:153/428 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NYKYFHGYFSLIVCILGTIANTLNIIVLTRREMRSPT-NAILTGLAVADLAVML----------- 73
            ||:::....|:.:       |..:.::|.|:.:||.: |.|:..:::.|:..||           
 Worm    38 NYEHYLSIASIFI-------NIFHFLILIRKPLRSSSINIIMAFISIFDICSMLFRMKQSYGPSI 95

  Fly    74 EYI--PYTVHDYILSVRLPREEQLSYSWACFIKFHSVFPQVLHTISIWLTVTLAVWRYIAVSYPQ 136
            |||  |.....:..:|.|   |::    ...:|.||      ...|.||..::|:.|.:.:..|.
 Worm    96 EYIFDPCMQSKWYFNVYL---EKI----LLVVKDHS------QRSSTWLLFSIALIRTLVIRNPM 147

  Fly   137 RNRI--WCGMRTTLITIATAYVVCV-LVVSPWLYLVTAIAKFLETLDANGKTIASVPLSQYILDY 198
            ..:.  .....|:|.|     ::|: |:..|     .:||.|.      |..|.|          
 Worm   148 NPKYERLAHPPTSLFT-----MICINLIFGP-----ISIATFF------GSDITS---------- 186

  Fly   199 NRQDEVTMQVMSSTTPDVSWAIPSDSANGTAVSLLSLTTVIPLTTLSTGVTTSSSLGERNVTVYK 263
              |:..     ||..||           |.....|.:               |:|..:.:..:.|
 Worm   187 --QNHT-----SSCDPD-----------GVLFYYLDI---------------SASYKQNDGMILK 218

  Fly   264 LYHSALALRDRQFRNATFLIYSVLIKLIPCFALTILSVRLIGALLEAKRRRKILACHAANDMQPI 328
            :|               .||.||:..:||||...|::|.|:..|.:|:..||             
 Worm   219 IY---------------TLINSVVSTIIPCFIFPIVTVFLVKELWKAEANRK------------- 255

  Fly   329 VNGKVVIPTQPKSCKLLEKEKQTD--RTTRMLLAVLLLFLVTEFPQGIMGLLNVLLGDAFFLQ-- 389
                          :|...:|..|  :.|:::|.:..:|.:.:||.||.      :|.::|..  
 Worm   256 --------------RLFSSKKVNDSSKNTQLVLFLTCVFFIAQFPIGIS------IGASYFFSET 300

  Fly   390 -----CYLKLSDLMDILALINSSINFILYCSMSRQFRS 422
                 ...::|.:..::.:.|:..:|.:...||.|:|:
 Worm   301 PGFMIILHEISYIFSVILVANTFSHFFICIFMSSQYRA 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsR2NP_001261323.1 7tm_4 28..429 CDD:304433 84/421 (20%)
srw-143NP_503798.3 7TM_GPCR_Srw 38..347 CDD:370978 86/428 (20%)
TM helix 2 69..94 CDD:320109 5/24 (21%)
TM helix 3 115..137 CDD:320109 6/31 (19%)
TM helix 4 162..178 CDD:320109 5/25 (20%)
TM helix 5 218..241 CDD:320109 11/37 (30%)
TM helix 6 267..292 CDD:320109 7/30 (23%)
TM helix 7 307..333 CDD:320109 3/25 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.