DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsR2 and srw-36

DIOPT Version :9

Sequence 1:NP_001261323.1 Gene:MsR2 / 38296 FlyBaseID:FBgn0264002 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_507224.2 Gene:srw-36 / 184481 WormBaseID:WBGene00005783 Length:297 Species:Caenorhabditis elegans


Alignment Length:307 Identity:58/307 - (18%)
Similarity:115/307 - (37%) Gaps:91/307 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KYFHGYFSLIVCILGTIANTLNIIVLTRREMRSPT-NAILTGLAVA----DLAVMLEYIPYTVHD 82
            |::....::.:..:|...:..:.:||.|:.||..| |..|.|:.|.    ::..::.||| .:.|
 Worm    22 KFYLHLINVAISFIGIFPSVFHFLVLLRKSMRQLTVNQFLIGIVVCGIIHNVCSIIYYIP-ILCD 85

  Fly    83 YILSVRLPRE---EQLSYSWACFIKFHSVFPQVLHTISIWLTVTLAVWRYIAVSYPQRNR----I 140
            :..|:::|.|   .|.||....:..:.|:...|...:..:.|..:|:.|.:.:.:|...|    |
 Worm    86 HYYSLKVPLECVPSQSSYVKIAYGFYSSLINSVAIVMITYFTAAMAIIRTLVIKFPLARRSKRLI 150

  Fly   141 WC--GMRTTLITIATAYVVCVLVVSPWLYLVTAIAKFLETLDANGKTIASVPLSQYILDYNRQDE 203
            :.  |.: .::||       :||:||:..:..|....:||                         
 Worm   151 YSKNGSK-IMLTI-------ILVISPFWIINFASLNVIET------------------------- 182

  Fly   204 VTMQVMSSTTPDVSWAIPSDSANGTAVSLLSLTTVIPLTTLSTGVTTSSSLGERNVTVYKLYHSA 268
                        ..| :|..:.||.:.:.:.         ...|:..:...|:....::      
 Worm   183 ------------GVW-VPPKNCNGFSKNNIE---------KMYGIEQTGIFGQLFYLIF------ 219

  Fly   269 LALRDRQFRNATFLIYSVLIKLIPCFALTILSVRLIGALLEAKRRRK 315
                        ||..:||.:.||...|.|.::.||   :|.::.:|
 Worm   220 ------------FLTETVLFEFIPSILLLITTICLI---IELRKNQK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsR2NP_001261323.1 7tm_4 28..429 CDD:304433 57/302 (19%)
srw-36NP_507224.2 7tm_GPCRs 28..>272 CDD:391938 57/301 (19%)
TM helix 2 57..82 CDD:341315 7/25 (28%)
TM helix 3 109..139 CDD:341315 5/29 (17%)
TM helix 4 153..169 CDD:341315 6/23 (26%)
TM helix 5 216..241 CDD:341315 8/42 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.