DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsR2 and M03F8.7

DIOPT Version :9

Sequence 1:NP_001261323.1 Gene:MsR2 / 38296 FlyBaseID:FBgn0264002 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001256063.1 Gene:M03F8.7 / 13213068 WormBaseID:WBGene00189957 Length:239 Species:Caenorhabditis elegans


Alignment Length:237 Identity:61/237 - (25%)
Similarity:95/237 - (40%) Gaps:73/237 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LSTGVTTSSSLGERNV--TVYKLYHSALALRDRQFRNATFLIYSVLIKLIPCFALTILSVRLIGA 306
            |..|..:|.|||..:|  |:.:.|:|...|        |||            :.|:.|..||  
 Worm    10 LPPGNNSSMSLGIVSVLETIERFYNSLHLL--------TFL------------SFTLNSAILI-- 52

  Fly   307 LLEAKRRRKI----------------LACHAAN-DMQPIVNGK---------------------- 332
            :|..|:.||:                ..|...| .:.|.:|||                      
 Worm    53 VLSHKQMRKLGINVMMMAIAFCDFGCSICVIVNFILGPPLNGKLEESYVNSVFHLVYDSITIGFH 117

  Fly   333 ---VVIPTQPKSCKLL------EKEKQTDRTTRMLLAVLLLFLVTEFPQGIMGLLNVLLGDAFFL 388
               :.|......|:::      ....:.||::.::|:||::||.||.||.|..:...|....|..
 Worm   118 SSSIFIGVGMAFCRIMSLTFSNRNRSRLDRSSSLILSVLIVFLFTELPQAITDIFGALFIADFLN 182

  Fly   389 QCYLKLSDLMDILALINSSINFILYCSMSRQFRSTFALLFRP 430
            .....|.|::|||:.:||::.|.:| |:|:|||..|...|.|
 Worm   183 HVITNLEDILDILSSVNSTVIFFIY-SLSQQFRQIFVETFVP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsR2NP_001261323.1 7tm_4 28..429 CDD:304433 59/234 (25%)
M03F8.7NP_001256063.1 7tm_GPCRs 41..>161 CDD:391938 24/133 (18%)
7tm_GPCRs <138..217 CDD:391938 28/79 (35%)
TM helix 6 143..173 CDD:341315 12/29 (41%)
TM helix 7 186..210 CDD:341315 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BWNV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.