Sequence 1: | NP_001261323.1 | Gene: | MsR2 / 38296 | FlyBaseID: | FBgn0264002 | Length: | 647 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001256063.1 | Gene: | M03F8.7 / 13213068 | WormBaseID: | WBGene00189957 | Length: | 239 | Species: | Caenorhabditis elegans |
Alignment Length: | 237 | Identity: | 61/237 - (25%) |
---|---|---|---|
Similarity: | 95/237 - (40%) | Gaps: | 73/237 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 244 LSTGVTTSSSLGERNV--TVYKLYHSALALRDRQFRNATFLIYSVLIKLIPCFALTILSVRLIGA 306
Fly 307 LLEAKRRRKI----------------LACHAAN-DMQPIVNGK---------------------- 332
Fly 333 ---VVIPTQPKSCKLL------EKEKQTDRTTRMLLAVLLLFLVTEFPQGIMGLLNVLLGDAFFL 388
Fly 389 QCYLKLSDLMDILALINSSINFILYCSMSRQFRSTFALLFRP 430 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
MsR2 | NP_001261323.1 | 7tm_4 | 28..429 | CDD:304433 | 59/234 (25%) |
M03F8.7 | NP_001256063.1 | 7tm_GPCRs | 41..>161 | CDD:391938 | 24/133 (18%) |
7tm_GPCRs | <138..217 | CDD:391938 | 28/79 (35%) | ||
TM helix 6 | 143..173 | CDD:341315 | 12/29 (41%) | ||
TM helix 7 | 186..210 | CDD:341315 | 10/24 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2BWNV | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |