DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-g2 and smp-30

DIOPT Version :9

Sequence 1:NP_647710.1 Gene:yellow-g2 / 38295 FlyBaseID:FBgn0035328 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001262580.1 Gene:smp-30 / 41786 FlyBaseID:FBgn0038257 Length:306 Species:Drosophila melanogaster


Alignment Length:212 Identity:40/212 - (18%)
Similarity:67/212 - (31%) Gaps:74/212 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 VYVSDAANRAIIVYNLQADRGFRVVL---------------PKAVTAGCRSRDVLY----IALIR 248
            :|..|..:..|..|:.:.::.:|..:               |:....||..|.|:.    ::.:.
  Fly    31 LYYVDLESAGINRYDFKQNKVYRAKIEGEIFASFILPVENKPQEFAVGCGLRTVIVQWDGVSAVA 95

  Fly   249 RDCGSTELYFTYLSTNKLFSLKSEYLRSGVADGRILDLGKKPSRMVIIGT--DNGSAIFFRNEGD 311
            :            .|..||.::.:     :.:.|:.|....|:.....||  |:|. ||.:.:| 
  Fly    96 K------------VTRTLFEVQPD-----LKENRLNDAKTDPNGRFYGGTMADSGD-IFTQWKG- 141

  Fly   312 AEVYRWD--------------TNSTFVEANFKPVYRSQTCQLVTHAVPDYKRNTMRVLQSN---- 358
             |:|.|.              :|....:...|..|...|   ..|.|..|..|......||    
  Fly   142 -ELYSWQAGGQPNAIRSKVGISNGLAWDVKAKKFYFIDT---NNHEVLAYDYNQSTGAVSNPKVI 202

  Fly   359 ------------FPDYM 363
                        |||.|
  Fly   203 FDLRKIRPEGPLFPDGM 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-g2NP_647710.1 MRJP 127..381 CDD:281074 40/212 (19%)
smp-30NP_001262580.1 SGL 18..277 CDD:285626 40/212 (19%)
NHL 168..>248 CDD:302697 13/55 (24%)
NHL repeat 168..208 CDD:271320 9/42 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.