DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-g2 and yellow-e2

DIOPT Version :9

Sequence 1:NP_647710.1 Gene:yellow-g2 / 38295 FlyBaseID:FBgn0035328 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster


Alignment Length:451 Identity:96/451 - (21%)
Similarity:160/451 - (35%) Gaps:102/451 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LHLALIL-----GFCLVGWARSQGTKYGLWTPDRAHSD--------SQPI--QWTGGQFEFPCAS 52
            |.|||::     ..||        .:|.|..|.....|        ..||  :|...|:.||...
  Fly     2 LILALVVWLAYPNLCL--------AQYHLNPPKTIFPDFKFPSDYRDTPIVFEWKNLQYGFPSEQ 58

  Fly    53 TKSLFKSSGKFIPKNVIATRAQLIGDTIY----------LALPRYRKGVPATLVKTSIKPGTCST 107
            .:.....:|::.|.:.|....    |..|          :..||:.:|||.:|...:.......:
  Fly    59 ERDQVLRNGRYNPDSPIPIDI----DVYYPPNGGPPRHFVTSPRFGQGVPFSLGYVTNVQRENGS 119

  Fly   108 TFKPYPC--WDLQEEGNCKALQSVVDLVVDQNEVLWVLDTGIVNTLETPVRKCPPKVVAMSVKTG 170
            ..:.||.  |......||..|.||..:.:|....:||||:|.:..    |:.|.|:|:...:.|.
  Fly   120 EIQAYPSYQWHSSHGANCDGLTSVYRVHIDACGQMWVLDSGEIEF----VQHCAPQVMVFDLATD 180

  Fly   171 KVLKTVSLEGLTSSNSRLQYLVVDYA------PDGGC---FVYVSDAANRAIIVYNLQADRGFRV 226
            :::....|.. ||..:::...|..:|      |.|.|   |.|::|..::||:||::.....:|:
  Fly   181 QLIHRYRLPE-TSYKAKVSRFVNIFADIRDPPPSGQCKDVFAYLADPTSKAIVVYDVVGQSSWRI 244

  Fly   227 ----VLPKAV----TAGCRSRDVL--YIALIRRDCG---STELYFTYLSTNKLFSLKSEYL---- 274
                ..|.|.    |....|.::|  .:||.....|   ...|.|..||.....::..:.|    
  Fly   245 ENKFTYPDAKFGTHTVAGESFELLDGPLALATTPLGLGLRRHLIFHALSNELELAIPLDILNNAT 309

  Fly   275 --RSGVAD--GRILDLGKKPSRMVIIGTDNGSAIFFRNEGDAEVYRWDTNSTFVEANFK------ 329
              :.|::.  .....|||:..:...........:|........::.||....:...|.|      
  Fly   310 NWQKGLSSSLSEFTVLGKRGIQCASHAISRQGFLFCGFLEPIGIFGWDIRRPYNRENVKLLAINP 374

  Fly   330 ---------PVYR------------SQTCQLVTHAVPDYKRNTMRVLQSNFPDYMQNRVGC 369
                     .:.|            |...|.:.....||:....||::.:..|.:|.| ||
  Fly   375 ATLQFVSGMKIVRRPADGREELWLLSDRLQKIFAGTIDYREINYRVMRCDVDDLLQGR-GC 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-g2NP_647710.1 MRJP 127..381 CDD:281074 63/300 (21%)
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 61/298 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449260
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.