DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-g2 and yellow-e3

DIOPT Version :9

Sequence 1:NP_647710.1 Gene:yellow-g2 / 38295 FlyBaseID:FBgn0035328 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_650288.1 Gene:yellow-e3 / 41651 FlyBaseID:FBgn0038150 Length:409 Species:Drosophila melanogaster


Alignment Length:282 Identity:66/282 - (23%)
Similarity:110/282 - (39%) Gaps:49/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LALILGFCLVGWARSQGTKYGLWTPDRAHSDSQPIQWTGGQFEFPCASTKSLFKSSGKFIPKNVI 69
            :.|:..||.|     ||....|......|      |||.       .|.........:|:|.:|.
  Fly     3 VVLLALFCAV-----QGQALVLKELHTLH------QWTN-------LSLGDDLSKGNRFLPVDVD 49

  Fly    70 ATRAQLIGDTIYLALPRYRKGVPATLVKTSIKPGTC--STTFKPYPCWDLQEE-----GNCKALQ 127
            ...........:|.:||.....|.||.....:....  :...:|||    .||     .||..:.
  Fly    50 IEYGDEGRHRTFLTIPRLGMATPFTLATVIAEHNELVENPRLEPYP----NEEWHVPPNNCSGIT 110

  Fly   128 SVVDLVVDQNEVLWVLDTGIVNTLETPVRKCPPKVVAMSVKTGKVLKTVSL--EGLTSSNSRLQY 190
            |.:...:|:...|||:|:|.||:|:.    |||:::...:...::::..:|  :....|.|....
  Fly   111 SAIRTYIDECWRLWVVDSGQVNSLQL----CPPQILTFDLVKDELVQRHALPPDSYIPSVSIFTA 171

  Fly   191 LVVDYAPDG------GCFVYVSDAANRAIIVYNLQADRGFRV----VLPKAVTAGCRSRD----V 241
            ||||.|..|      |...|::||....:||::....|.:|:    :.|..:....||.:    :
  Fly   172 LVVDLAERGTPNRCVGGRAYIADAWGYGLIVFDSLTGRSWRIEHESMKPSPLLRLGRSSNSQAGI 236

  Fly   242 LYIALIRRDCGSTELYFTYLST 263
            ..::|...:.....|||..|::
  Fly   237 FTVSLSPSEVEDRFLYFHTLNS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-g2NP_647710.1 MRJP 127..381 CDD:281074 38/153 (25%)
yellow-e3NP_650288.1 MRJP 110..397 CDD:281074 38/153 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449262
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.