DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-g2 and yellow-c

DIOPT Version :9

Sequence 1:NP_647710.1 Gene:yellow-g2 / 38295 FlyBaseID:FBgn0035328 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001285947.1 Gene:yellow-c / 34879 FlyBaseID:FBgn0041713 Length:438 Species:Drosophila melanogaster


Alignment Length:461 Identity:103/461 - (22%)
Similarity:169/461 - (36%) Gaps:130/461 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LALILGFCLVG-WARSQGTKYGLWTPDRAHSDSQPIQWTGGQFEFPCASTKSLFKSSGKFIPKNV 68
            |:|.|..||:| ::|....|.           .:...|....|::|....::..||:|.:|.:|.
  Fly     7 LSLGLMVCLIGAFSRIASAKL-----------EEKFSWKQLAFDWPTPEAEAEAKSNGHYIVENN 60

  Fly    69 IATRAQLIGDTIYLALPRYRKGVPATLVKTSIKPGTCSTTFKPYPCWD----------------- 116
            :....:...:.|::.:||::.||.|||....|.....|....|||.|:                 
  Fly    61 LPLGVERWQNRIFVTVPRWKAGVAATLNYIDINSTEKSPKLHPYPSWEANKLPIDVQPQDQKTPS 125

  Fly   117 -------------LQEEGNCKALQSVVDLVVDQNEVLWVLDTGIVNTLETPVRKCPPKVVAMSVK 168
                         :|.:.|...: |...:.||..:.|||||||:.:.|.:|.:..|..::...:|
  Fly   126 GGRLDADKAQDAGIQLKDNSTVI-STFRIQVDVCDRLWVLDTGLADILGSPKQITPNSILVFDLK 189

  Fly   169 TGKVLKTVSLEG-LTSSNSRLQYLVVDYAPDGGC---FVYVSDAANRAIIVYNLQADRGFRV--- 226
            |..:|:..::.. .|..:|....:||| |....|   |.|:.|.....:|||:|:.|:.:||   
  Fly   190 TDTLLRRFTIPADQTKEDSFFANIVVD-ADRSECQDAFAYIPDLGAYGVIVYSLRNDKSYRVKHN 253

  Fly   227 -----------------------VLPKAVTAGCRSRDVLYIALIRRDCGSTELYFTYLSTNKLFS 268
                                   |...||  |..:.|           .|.::||..|::.|.|.
  Fly   254 FFHFDPLHGDFNVGGVNFQWTDGVFGLAV--GPMNPD-----------HSKDIYFHALASTKEFK 305

  Fly   269 LKSEYLRSGVADGRILDLGKKPSRMVIIGTDNGSAIFFRNEGD--------AEVYRWDTNSTFVE 325
            :.:..|::   :..:              |...|...|:..||        |||:..:|...|..
  Fly   306 VSNRVLQN---ESHV--------------TAGDSYYDFKYVGDRGMNGQSTAEVFDPETGVIFYT 353

  Fly   326 A---------NFKPVYRSQTCQLV---THAV---PDYK---RNTMRVLQSNFPDYMQNRVGCGAI 372
            .         |.|..|...|..|:   :|.:   .|.|   ..|:.||....|.|:...:...|:
  Fly   354 QVNKDAIACWNIKRPYTPDTQGLIDSDSHTLVFPNDMKIDNEGTIWVLSDKMPTYLYKELDPSAV 418

  Fly   373 QQLGLM 378
            ....||
  Fly   419 NYRILM 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-g2NP_647710.1 MRJP 127..381 CDD:281074 71/308 (23%)
yellow-cNP_001285947.1 MRJP 148..436 CDD:281074 71/309 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449264
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.