DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-g2 and y

DIOPT Version :9

Sequence 1:NP_647710.1 Gene:yellow-g2 / 38295 FlyBaseID:FBgn0035328 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_476792.1 Gene:y / 30980 FlyBaseID:FBgn0004034 Length:541 Species:Drosophila melanogaster


Alignment Length:415 Identity:88/415 - (21%)
Similarity:159/415 - (38%) Gaps:89/415 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GWARSQGTKYGLWTPD-RAHSDSQPIQWTGGQFEFPCASTKSLFKSSGKFIPKNVIATRAQLIGD 78
            ||...  |...|.||. .|:...:...|:...|.||....|....:||.:||:|.:....:..|:
  Fly     6 GWILV--TLITLVTPSWAAYKLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEHFGN 68

  Fly    79 TIYLALPRYRKGVPATLVKTSI-KPGTCSTTFKPYPCWDLQEEGNC-KALQSVVDLVVDQNEVLW 141
            .:::.:||:|.|:||||...:: :..|.|....|||.|.....|:| .::.:...:.||:...||
  Fly    69 RLFVTVPRWRDGIPATLTYINMDRSLTGSPELIPYPDWRSNTAGDCANSITTAYRIKVDECGRLW 133

  Fly   142 VLDTGIVNTLETPVRKCPPKVVAMSVKTGKVLKTVSLEGL-TSSNSRLQYLVVDYAPD-GGCFVY 204
            |||||.|....|....||..|....:.|...::...|.|: |:.|:.:..:.||...: ...:.|
  Fly   134 VLDTGTVGIGNTTTNPCPYAVNVFDLTTDTRIRRYELPGVDTNPNTFIANIAVDIGKNCDDAYAY 198

  Fly   205 VSDAANRAIIVYNLQADRGFR-----VVLPKAVTAGCRSRDV-----------LYIALIRRDCGS 253
            .:|.....:|.|:.:.::.:|     ...|..:........:           :.::.||.| |.
  Fly   199 FADELGYGLIAYSWELNKSWRFSAHSYFFPDPLRGDFNVAGINFQWGEEGIFGMSLSPIRSD-GY 262

  Fly   254 TELYFTYLSTNKLFSLKSEYLR-------------------------------SGVADGRILD-- 285
            ..|||:.|::::.|::.:..||                               .|:....::|  
  Fly   263 RTLYFSPLASHRQFAVSTRILRDETRTEDSYHDFVALDERGPNSHTTSRVMSDDGIELFNLIDQN 327

  Fly   286 --------LGKKPSRMVIIGTDNGSAIFFRNEGDAEVYRWDTNST-----------------FVE 325
                    :...|....|:..|:...:|   ..|.::   |.|..                 :.:
  Fly   328 AVGCWHSSMPYSPQFHGIVDRDDVGLVF---PADVKI---DENKNVWVLSDRMPVFLLSDLDYSD 386

  Fly   326 ANFKPVYRSQTCQLVTHAVPDYKRN 350
            .||: :|.:....|:.:.|.|.:.|
  Fly   387 TNFR-IYTAPLATLIENTVCDLRNN 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-g2NP_647710.1 MRJP 127..381 CDD:281074 54/300 (18%)
yNP_476792.1 MRJP 119..405 CDD:308585 51/293 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449258
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.