DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-g2 and Rgn

DIOPT Version :9

Sequence 1:NP_647710.1 Gene:yellow-g2 / 38295 FlyBaseID:FBgn0035328 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_033086.1 Gene:Rgn / 19733 MGIID:108024 Length:299 Species:Mus musculus


Alignment Length:143 Identity:33/143 - (23%)
Similarity:53/143 - (37%) Gaps:39/143 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ALQSVVDLVVDQNEVLWVLDTGI---VNTLETPVRKCPPKVVAMSVKTGKVLKTVSLEGLTSSNS 186
            :::...|.|...|.:.|.||..|   :::|...|     ......::||::           ||.
Mouse   142 SVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTV-----DAFDYDLQTGQI-----------SNR 190

  Fly   187 RLQYLVV--DYAPDGGCFVYVSDAANRA-IIVYN------LQADRGFR---VVLPKAVTAGC--- 236
            |:.|.:.  :..|||.|.    ||..:. :..||      |..:.|.|   |.||...|..|   
Mouse   191 RIVYKMEKDEQIPDGMCI----DAEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFG 251

  Fly   237 -RSRDVLYIALIR 248
             :....:|:...|
Mouse   252 GKDYSEMYVTCAR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-g2NP_647710.1 MRJP 127..381 CDD:281074 33/141 (23%)
RgnNP_033086.1 SGL 16..264 CDD:400653 32/141 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.