DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-g and yellow-e

DIOPT Version :9

Sequence 1:NP_523888.1 Gene:yellow-g / 38294 FlyBaseID:FBgn0041709 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_524344.1 Gene:yellow-e / 41653 FlyBaseID:FBgn0041711 Length:530 Species:Drosophila melanogaster


Alignment Length:334 Identity:100/334 - (29%)
Similarity:152/334 - (45%) Gaps:48/334 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YVPRNVIVTRAQLQRDSAFVALPRYKQGVPFTLGKVNLKK-GECLTKIAPYPCWAIQEEG----N 132
            |.|:||::|...:..|..|||.|:...|||.|:..|:..: |:..| :..:|.|.....|    |
  Fly    50 YNPQNVLITGLAVTDDRIFVATPKLFSGVPSTVSWVSKAQFGDSPT-LNAFPDWTFSNTGRSDFN 113

  Fly   133 CQ--ALQSVVDIAVDQNGLLWALDVGIVNTLEQPIRRCSPKIVAINTANHKVVKSIDL-SDLVTS 194
            |.  .|.||..:.||....:|.||.||..:||.....|.|||:.::.|..:||:.||. .:::..
  Fly   114 CSDLILTSVYRLRVDSCNRIWLLDAGISRSLEDYEITCPPKILVVDLATDRVVRRIDFPPEVLRG 178

  Fly   195 ESRLQFIVVDYSKD---NKPFVYVADAGARSILVYDITGNKSYRIVLPKATAPTSD--------- 247
            ||....:|:|.:..   :..|||:.|.....|:|||...:.::|:..| |..|..|         
  Fly   179 ESLFTNMVIDETTAKGCDDVFVYITDTVEPGIIVYDSGKDVTWRVSHP-AMYPDPDFAQSEIHEH 242

  Fly   248 --VL---YVALTSKPDGTSTLFFSYLSSPRLYSIKGEYLRVGQ-GAGSIIDVGPKPYGKQAV--- 303
              ||   .|.||. .:.|..::|..|::.|::|:....||.|. ..|.::||  |..||::.   
  Fly   243 RFVLMDGVVGLTF-DERTGVVYFQPLATDRVFSVHKNVLRAGPLPDGKMLDV--KLVGKKSSQGI 304

  Fly   304 -LLGADGGTSLFFRYKGENDIYLWDSET------CFKAANLQEVQRGGDCRLSTQVLPGHKRFMW 361
             |..:...:||.|....|..|..|:..|      .|....||.|   .|. .:|:..||   .::
  Fly   305 GLAVSPFDSSLIFSPLSETAIASWNPTTNQQSVLAFDRDQLQFV---ADI-TTTKSEPG---VIY 362

  Fly   362 ALESNFHDF 370
            |:.|.||.|
  Fly   363 AIASKFHRF 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-gNP_523888.1 MRJP 137..391 CDD:281074 77/263 (29%)
yellow-eNP_524344.1 MRJP 120..393 CDD:281074 77/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449250
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.