DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-g and yellow-e3

DIOPT Version :9

Sequence 1:NP_523888.1 Gene:yellow-g / 38294 FlyBaseID:FBgn0041709 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_650288.1 Gene:yellow-e3 / 41651 FlyBaseID:FBgn0038150 Length:409 Species:Drosophila melanogaster


Alignment Length:240 Identity:58/240 - (24%)
Similarity:106/240 - (44%) Gaps:29/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SLH-WPCESTKNIYVQSGRYVPRNVIVTRAQLQRDSAFVALPRYKQGVPFTLGKVNLKKGECL-- 116
            :|| |...|..:...:..|::|.:|.:......|...|:.:||.....||||..|..:..|.:  
  Fly    24 TLHQWTNLSLGDDLSKGNRFLPVDVDIEYGDEGRHRTFLTIPRLGMATPFTLATVIAEHNELVEN 88

  Fly   117 TKIAPYPC--WAIQEEGNCQALQSVVDIAVDQNGLLWALDVGIVNTLEQPIRRCSPKIVAINTAN 179
            .::.|||.  |.: ...||..:.|.:...:|:...||.:|.|.||:|:    .|.|:|:..:...
  Fly    89 PRLEPYPNEEWHV-PPNNCSGITSAIRTYIDECWRLWVVDSGQVNSLQ----LCPPQILTFDLVK 148

  Fly   180 HKVVK--SIDLSDLVTSESRLQFIVVDYSKDNKP------FVYVADAGARSILVYDITGNKSYRI 236
            .::|:  ::.....:.|.|....:|||.::...|      ..|:|||....::|:|....:|:||
  Fly   149 DELVQRHALPPDSYIPSVSIFTALVVDLAERGTPNRCVGGRAYIADAWGYGLIVFDSLTGRSWRI 213

  Fly   237 V-----------LPKATAPTSDVLYVALTSKPDGTSTLFFSYLSS 270
            .           |.:::...:.:..|:|:........|:|..|:|
  Fly   214 EHESMKPSPLLRLGRSSNSQAGIFTVSLSPSEVEDRFLYFHTLNS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-gNP_523888.1 MRJP 137..391 CDD:281074 35/153 (23%)
yellow-e3NP_650288.1 MRJP 110..397 CDD:281074 35/153 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449251
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.