DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-g and yellow-f2

DIOPT Version :9

Sequence 1:NP_523888.1 Gene:yellow-g / 38294 FlyBaseID:FBgn0041709 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_650247.1 Gene:yellow-f2 / 41596 FlyBaseID:FBgn0038105 Length:452 Species:Drosophila melanogaster


Alignment Length:338 Identity:80/338 - (23%)
Similarity:134/338 - (39%) Gaps:48/338 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YVPRNVIVTRAQLQRDSAFVALPRYKQGVPFTLGKVNLKK--GECLTKIAPYPCWAI-QEEGNCQ 134
            |:|.|.:...|...|...||.:||.:.|:|.||..::|.:  .....|:..||.:|: |...:.:
  Fly    96 YIPYNNVPMGATHFRGRLFVTMPRRRVGIPSTLNYIDLAEDGSNRSPKLRAYPNFALNQFNASAE 160

  Fly   135 ALQSVVDIAVDQNGLLWALDVGIVNTLEQP-----IRRCSPKIVAINTANHKVVKSIDLSDLVTS 194
            .|.||...:||....||.:|.|:   ||.|     |||  |.|..::.|..:|:|..|:.:.:..
  Fly   161 NLVSVYRTSVDACQRLWFIDTGM---LEYPNNRQQIRR--PSIWVVDLATDQVLKRFDVPESIAE 220

  Fly   195 ESR-LQFIVVDY--SKDNKPFVYVADAGARSILVYDITGNK--------------SYRIVLPKAT 242
            ..| |..|.||.  .:....:.|:.|...|.:.||.:..::              |..:.:...|
  Fly   221 TGRGLASITVDVKAGQCGDAYAYIPDLVYRRLYVYHLRNDRIWSFEHNYFNFDPLSGDLSIGGQT 285

  Fly   243 APTSDVLY-VAL-TSKPDGTSTLFFSYLSSPRLYSIKGEYLRVGQGA-----GSIIDV-GPKPYG 299
            ....|.:: :.| ..|.||:...:|..::|...:.:....|:....|     |:...| |.:...
  Fly   286 FRWDDGIFSITLGAQKLDGSRDAYFHPMASTNEFVVSNRVLQQESNAARSDHGNDFRVLGSRGPS 350

  Fly   300 KQAVLLGADGGTS-LFFRYKGENDIYLWDSETCFKAANLQEVQRGGDCRLSTQVLPGHKRF---- 359
            .|:.:...|.||. :||.....|.:..|.:.....|.|...|    |......:.|.....    
  Fly   351 TQSTMHAYDPGTGVIFFDEIQRNGVGCWKTSKPISAENYGSV----DSNAEDMIYPSDLSIDEDG 411

  Fly   360 -MWALESNFHDFI 371
             :|.:.::...||
  Fly   412 TIWVMSNSMPIFI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-gNP_523888.1 MRJP 137..391 CDD:281074 60/271 (22%)
yellow-f2NP_650247.1 MRJP 163..451 CDD:281074 60/271 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449255
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.