DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-g and yellow-f

DIOPT Version :9

Sequence 1:NP_523888.1 Gene:yellow-g / 38294 FlyBaseID:FBgn0041709 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_524335.1 Gene:yellow-f / 41595 FlyBaseID:FBgn0041710 Length:429 Species:Drosophila melanogaster


Alignment Length:353 Identity:79/353 - (22%)
Similarity:139/353 - (39%) Gaps:62/353 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 STKNIYVQSGRYVPRNVIVTRAQLQRDSAFVALPRYKQGVPFTLGKVNLKKG--ECLTKIAPYPC 124
            |:...::|... ||:.|...|.:|     ||.:||.:.|:|.||..::|.|.  .....:..||.
  Fly    68 SSSGSFIQYNN-VPQGVTHFRGRL-----FVTVPRRQPGIPSTLNYIDLAKDGWSQSPHLRAYPN 126

  Fly   125 WAI-QEEGNCQALQSVVDIAVDQNGLLWALDVGIVNTLEQPIRRCS---PKIVAINTANHKVVKS 185
            .|: |...:.|.|.||...:||..|.||.:|.|:   ||.|..|..   |.|..|:.||.:::|.
  Fly   127 LAVNQYNASEQNLVSVYRTSVDVCGRLWFVDTGM---LEFPNNRQQIRHPSIWVIDLANDRLLKR 188

  Fly   186 IDLSDLVTSESR-LQFIVVDYS--KDNKPFVYVADAGARSILVYDITGNK--------------S 233
            .::...:....| |..|.:|..  :.|..:.|:.|...|.:.||.:..::              |
  Fly   189 FEIPQSIVEIGRGLASITIDVGARRCNDAYAYIPDLVNRRLHVYHLRSDRIWSFEHSFFNFDPLS 253

  Fly   234 YRIVLPKATAPTSDVLYVAL--TSKPDGTSTLFFSYLSSPRLYSIKGEYLRVGQGAGSIIDVGPK 296
            ..:.:...|....|.::.|.  :.||||:..:||..::|...:.:....|:      ...:....
  Fly   254 DNLNIGGQTFRWDDGIFSATLGSYKPDGSRDVFFHPMASTNEFVVSNRVLQ------QEFNAARS 312

  Fly   297 PYGKQAVLLGADGGTS-------------LFFRYKGENDIYLWDSETCFKAANLQEVQRGGDCRL 348
            .:|....|||..|.::             :||....::.:..|.:...|...|...|....    
  Fly   313 DHGDDFHLLGTRGPSTQSTMHKYDPRTGVIFFAEVQKSGVGCWKTSKPFSTENHGSVYSNS---- 373

  Fly   349 STQVLPG-----HKRFMWALESNFHDFI 371
            |..:.|.     .:.::|.:.::...|:
  Fly   374 SEMIYPSDLTIDEEGYIWVMSNSMPIFV 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-gNP_523888.1 MRJP 137..391 CDD:281074 56/275 (20%)
yellow-fNP_524335.1 MRJP 140..428 CDD:281074 56/275 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449254
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.