DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-g and yellow-g2

DIOPT Version :9

Sequence 1:NP_523888.1 Gene:yellow-g / 38294 FlyBaseID:FBgn0041709 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_647710.1 Gene:yellow-g2 / 38295 FlyBaseID:FBgn0035328 Length:382 Species:Drosophila melanogaster


Alignment Length:389 Identity:173/389 - (44%)
Similarity:253/389 - (65%) Gaps:35/389 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLQLLLLVASASVVLAGYSSSTDESTDASNSIGGTK----------CDKNPLNELTFQLSGSSLH 57
            :|.|.|::   ...|.|::.|.           |||          .|..|:     |.:|....
  Fly     2 RLHLALIL---GFCLVGWARSQ-----------GTKYGLWTPDRAHSDSQPI-----QWTGGQFE 47

  Fly    58 WPCESTKNIYVQSGRYVPRNVIVTRAQLQRDSAFVALPRYKQGVPFTLGKVNLKKGECLTKIAPY 122
            :||.|||:::..||:::|:|||.|||||..|:.::|||||::|||.||.|.::|.|.|.|...||
  Fly    48 FPCASTKSLFKSSGKFIPKNVIATRAQLIGDTIYLALPRYRKGVPATLVKTSIKPGTCSTTFKPY 112

  Fly   123 PCWAIQEEGNCQALQSVVDIAVDQNGLLWALDVGIVNTLEQPIRRCSPKIVAINTANHKVVKSID 187
            |||.:||||||:|||||||:.||||.:||.||.|||||||.|:|:|.||:||::....||:|::.
  Fly   113 PCWDLQEEGNCKALQSVVDLVVDQNEVLWVLDTGIVNTLETPVRKCPPKVVAMSVKTGKVLKTVS 177

  Fly   188 LSDLVTSESRLQFIVVDYSKDNKPFVYVADAGARSILVYDITGNKSYRIVLPKATAP---TSDVL 249
            |..|.:|.||||::||||:.|...||||:||..|:|:||::..::.:|:|||||...   :.|||
  Fly   178 LEGLTSSNSRLQYLVVDYAPDGGCFVYVSDAANRAIIVYNLQADRGFRVVLPKAVTAGCRSRDVL 242

  Fly   250 YVALTSKPDGTSTLFFSYLSSPRLYSIKGEYLRVGQGAGSIIDVGPKPYGKQAVLLGADGGTSLF 314
            |:||..:..|::.|:|:|||:.:|:|:|.||||.|...|.|:|:|.||  .:.|::|.|.|:::|
  Fly   243 YIALIRRDCGSTELYFTYLSTNKLFSLKSEYLRSGVADGRILDLGKKP--SRMVIIGTDNGSAIF 305

  Fly   315 FRYKGENDIYLWDSETCFKAANLQEVQRGGDCRLSTQVLPGHKR-FMWALESNFHDFISDRTGC 377
            ||.:|:.::|.||:.:.|..||.:.|.|...|:|.|..:|.:|| .|..|:|||.|::.:|.||
  Fly   306 FRNEGDAEVYRWDTNSTFVEANFKPVYRSQTCQLVTHAVPDYKRNTMRVLQSNFPDYMQNRVGC 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-gNP_523888.1 MRJP 137..391 CDD:281074 115/245 (47%)
yellow-g2NP_647710.1 MRJP 127..381 CDD:281074 115/245 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449244
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D317268at33208
OrthoFinder 1 1.000 - - FOG0012731
OrthoInspector 1 1.000 - - otm49599
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.