DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-g and yellow-b

DIOPT Version :9

Sequence 1:NP_523888.1 Gene:yellow-g / 38294 FlyBaseID:FBgn0041709 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001285987.1 Gene:yellow-b / 35005 FlyBaseID:FBgn0032601 Length:453 Species:Drosophila melanogaster


Alignment Length:381 Identity:95/381 - (24%)
Similarity:142/381 - (37%) Gaps:86/381 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ELTFQLSGSSLHWPCESTKNIYVQSGRYVPRNVIVTRAQLQRDSAFVALPRYKQGVPFTLGKVNL 110
            |:.|:.:.....|..       ::.|.:.|.|||....::.....||.|||::.|||.:|..::|
  Fly    30 EMDFKYANPDQRWSA-------IERGEFKPANVIPFGLEVAGHRLFVTLPRWRDGVPASLAYLDL 87

  Fly   111 ----KKGECLTKIAPYPCWAIQEEGNCQ----ALQSVVDIAVDQNGLLWALDVGIVNTLEQPIRR 167
                .||..|   .|:|.|   :..|.|    .|.|...:..|:.|.||.||..|...|||    
  Fly    88 NDTSSKGPAL---KPFPSW---QAHNLQEAEPELVSPFRVRADRCGRLWVLDSRISGVLEQ---- 142

  Fly   168 CSPKIVAINTANHKVVKSIDLSDLVTSE----------SRLQFIVVDYSKDNKPFVYVADAGARS 222
                 ..|..|...:|..:...||:...          |.|..:.|:.|.....|.|.||.|:..
  Fly   143 -----TKIYGAAQLLVYDLHNDDLLRRHVLPAGQLKQGSLLANLAVEDSDCENTFAYAADLGSPG 202

  Fly   223 ILVYDITGNKSYRI----VLPKATAPT----------SDVLYVALTSKP--DGTSTLFFSYLSSP 271
            ::||.....:|:|:    ..|...|..          .|.||....|||  .|.:||:|..|.|.
  Fly   203 LVVYSWKDEESWRVQHHFFHPDPMAGNFSINGIEFQWDDGLYGLALSKPLETGYATLYFHPLCST 267

  Fly   272 RLYSIKGEYLRVGQGAGSIIDVGPKPYGKQAVLLGADGGTS-------------LFFRYKGENDI 323
            ..:|:....||     ...:...|..| ::..:||:.|..:             ||:.....|::
  Fly   268 TEFSVDTSILR-----NKTLATSPMIY-REFKVLGSRGPNTQAGAEFLDPDTGVLFYALPNLNEV 326

  Fly   324 YLWDSETCFKAANLQEVQRGGDCRLSTQVLPG------HKRFMWALESNFHDFISD 373
            ..|.:.|.|..::...:....|    |.|.|.      .|| :|.|.:....||.|
  Fly   327 ACWRTATDFSHSSQSRIHMNND----TLVFPSDIKVDDQKR-LWVLSNQLPVFIYD 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-gNP_523888.1 MRJP 137..391 CDD:281074 68/282 (24%)
yellow-bNP_001285987.1 MRJP 116..402 CDD:281074 68/282 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449245
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.