DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-g and regucalcin

DIOPT Version :9

Sequence 1:NP_523888.1 Gene:yellow-g / 38294 FlyBaseID:FBgn0041709 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_727588.2 Gene:regucalcin / 32165 FlyBaseID:FBgn0030362 Length:319 Species:Drosophila melanogaster


Alignment Length:333 Identity:68/333 - (20%)
Similarity:104/333 - (31%) Gaps:109/333 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLLVASASVVLAGYSSSTDESTDASNSIGGTKCDKNPLNELTFQLSGSSLHWPCESTKNIYV-- 68
            ::||:...:|.|.|.:.|               ....||.: ::...|...||........||  
  Fly     1 MMLLIPVIAVCLFGLTMS---------------YKVEPLPD-SYAGLGEGPHWDVARQSLYYVDL 49

  Fly    69 QSGR-----YVPRNVIVTRAQLQRDSAFVALPRYKQGVPFTLG-------------KVNLKKGEC 115
            ::|.     |....|..|:.:.:..:.|| ||...:...|.:|             ..:.|....
  Fly    50 EAGSLLRYDYAQNKVYKTKIEGETLAGFV-LPVEGRPQEFAVGCGRRVVIVNWDGVSPSAKVVRT 113

  Fly   116 LTKIAPYPCWAIQEEGNCQALQSVVDIAVDQNGLL---------------------WAL------ 153
            |.::.|     :.|:....      |..||..|..                     |..      
  Fly   114 LFEVQP-----LMEKNRLN------DAKVDPRGRFFGGTMRYIGDEFEFRHGELYRWEAGGQVSV 167

  Fly   154 ---DVGIVNTLEQPIRRCSPKIVAINTANHKVVKSIDLSDLVTSESRLQFIVVDYSK-------- 207
               ||||.|.|....:  :.|...|:|.::: |||.|. |..|..:....::.:..|        
  Fly   168 IKGDVGISNGLAWDEK--AKKFYYIDTTDYE-VKSYDY-DFETGVASNPKVIFNLRKNSPKDHLL 228

  Fly   208 ------DNKPFVYVAD-AGARSILVYDITGNKSYRIVLPKAT-------APTSDVLYVALTSK-- 256
                  |.:..:|||. .||....|...||.....|..|...       .|..|:|||...:|  
  Fly   229 PDGLTIDTEGNLYVATFNGATIYKVNPNTGKILLEIKFPTKQITSAAFGGPNLDILYVTTAAKFD 293

  Fly   257 ---PDGTS 261
               |.||:
  Fly   294 QPAPAGTT 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-gNP_523888.1 MRJP 137..391 CDD:281074 41/182 (23%)
regucalcinNP_727588.2 SGL 31..290 CDD:285626 56/274 (20%)
NHL <229..302 CDD:302697 20/73 (27%)
NHL repeat 229..259 CDD:271320 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.