DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-g and Rgn

DIOPT Version :9

Sequence 1:NP_523888.1 Gene:yellow-g / 38294 FlyBaseID:FBgn0041709 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_113734.1 Gene:Rgn / 25106 RGDID:3560 Length:299 Species:Rattus norvegicus


Alignment Length:158 Identity:38/158 - (24%)
Similarity:60/158 - (37%) Gaps:40/158 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 NHKVVKSIDLSDLVTSESRLQFIVVDYSKDNKPFVYVADAGARSILVYDI---TGNKSYRIVLPK 240
            :|.|.|..|..|:...        :|:|.|:|.|.|: |:.:.::..:|.   ||..|.|..:.|
  Rat   140 DHSVKKYFDQVDISNG--------LDWSLDHKIFYYI-DSLSYTVDAFDYDLPTGQISNRRTVYK 195

  Fly   241 ATAPTSDVLYVALTSKPDGTSTLFFSYLSSPRLYSIKGEYLRVGQGAGSIIDVGPKPYGK--QAV 303
            ....         ...|||            ....::|:........|.:|.:.|:. ||  |.|
  Rat   196 MEKD---------EQIPDG------------MCIDVEGKLWVACYNGGRVIRLDPET-GKRLQTV 238

  Fly   304 LLGADGGTSLFFRYKGENDIYLWDSETC 331
            .|..|..||..|..|..:::|:    ||
  Rat   239 KLPVDKTTSCCFGGKDYSEMYV----TC 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-gNP_523888.1 MRJP 137..391 CDD:281074 38/158 (24%)
RgnNP_113734.1 SGL 16..264 CDD:285626 38/158 (24%)
NHL 166..>237 CDD:302697 17/93 (18%)
WD40 repeat 203..239 CDD:293791 10/48 (21%)
NHL repeat 203..237 CDD:271320 9/46 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.