DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-g and Rgn

DIOPT Version :9

Sequence 1:NP_523888.1 Gene:yellow-g / 38294 FlyBaseID:FBgn0041709 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_033086.1 Gene:Rgn / 19733 MGIID:108024 Length:299 Species:Mus musculus


Alignment Length:310 Identity:71/310 - (22%)
Similarity:107/310 - (34%) Gaps:95/310 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GSSLHWPCESTKNIYVQSGRYVPRNVI---------VTRAQLQRDSAFVALPRYKQGVPFTLGKV 108
            |.|..|...|...::|.    :|..:|         |.|..:....:.||| |...|...|:|  
Mouse    17 GESPVWEEASQSLLFVD----IPSKIICRWDTVSNQVQRVAVDAPVSSVAL-RQLGGYVATIG-- 74

  Fly   109 NLKKGECLTKIAPYPCWAIQEEGNCQALQSVVDIA-VDQNGLLWALDVGIVNTLEQPIRRCSPKI 172
                    ||..     |:..|.     |||..:| ||::......:.|.|:    |..|.....
Mouse    75 --------TKFC-----ALNWEN-----QSVFVLAMVDEDKKNNRFNDGKVD----PAGRYFAGT 117

  Fly   173 VAINTA----------------NHKVVKSIDLSDLVTSESRLQFIVVDYSKDNKPFVYVADAGAR 221
            :|..||                :|.|.|..|..|:...        :|:|.|:|.|.|: |:.:.
Mouse   118 MAEETAPAVLERHQGSLYSLFPDHSVKKYFDQVDISNG--------LDWSLDHKIFYYI-DSLSY 173

  Fly   222 SILVYDI---TGNKSYRIVLPKATAPTSDVLYVALTSKPDGTSTLFFSYLSSPRLYSIKGEYLRV 283
            ::..:|.   ||..|.|.::.|....         ...|||            .....:|:....
Mouse   174 TVDAFDYDLQTGQISNRRIVYKMEKD---------EQIPDG------------MCIDAEGKLWVA 217

  Fly   284 GQGAGSIIDVGPKPYGK--QAVLLGADGGTSLFFRYKGENDIYLWDSETC 331
            ....|.:|.:.|:. ||  |.|.|..|..||..|..|..:::|:    ||
Mouse   218 CYNGGRVIRLDPET-GKRLQTVKLPVDKTTSCCFGGKDYSEMYV----TC 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-gNP_523888.1 MRJP 137..391 CDD:281074 51/217 (24%)
RgnNP_033086.1 SGL 16..264 CDD:400653 71/310 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.