DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32302 and Gasp

DIOPT Version :10

Sequence 1:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster


Alignment Length:247 Identity:47/247 - (19%)
Similarity:76/247 - (30%) Gaps:77/247 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 FSC-QQAGLFPDPYDCRRYHECSDQSVDTPRICSNGAGYSTLTGTCVLPRESEQCIQEQFTCSRS 154
            |.| ...|.:|....|.:|.:| |..|...:.|.||..:.                         
  Fly    21 FKCPDDFGFYPHDTSCDKYWKC-DNGVSELKTCGNGLAFD------------------------- 59

  Fly   155 GQVGGWAPDNRYFYVCVNDTANSLYPLMMKCHEGFVFNSYSCVPDTRSMRSIQAMESHTCMNNDR 219
                  |.|::|.      |.|..|...:.|.:..........|....:..|..         |.
  Fly    60 ------ATDSKYL------TENCDYLHNVDCGDRTELEPPITTPHCSRLYGIFP---------DE 103

  Fly   220 YQCPFRTSEIEYCKCVDGELEVMTCPAGFQIDPKILTCV-TDRIYQCSDFEI---LSCP------ 274
            .:|..      :..|.:||.....|..|...|.....|: .|::.:|.:.|:   .|||      
  Fly   104 NKCDV------FWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPECKNEEVANGFSCPAAGELA 162

  Fly   275 -------NVSTKD--EYCICIDHQLQIYSCPMGQYF----NAETRKCQSESE 313
                   :...:|  :|.||::...:.|.||:|..|    :..|..|:...:
  Fly   163 NAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKIGDSDGTGNCEDPED 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32302NP_728732.1 CBM_14 94..144 CDD:426342 10/49 (20%)
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 17/88 (19%)
CBM_14 97..144 CDD:426342 11/61 (18%)
CBM_14 170..218 CDD:426342 11/45 (24%)

Return to query results.
Submit another query.