DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32302 and CG17147

DIOPT Version :9

Sequence 1:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:367 Identity:71/367 - (19%)
Similarity:117/367 - (31%) Gaps:115/367 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CLILLALALGSAWAN--DNPCQ------DVRIPGFVCMNCTTLGYCIRDATGSWETISMLGCQSE 64
            |::|||....||...  :..|:      .||.||    .|.....|. |..|     ::|.|.|.
  Fly    12 CVLLLATVALSASVGEYEELCRLFKNGTKVRKPG----TCDQYIQCY-DGNG-----TVLTCPSN 66

  Fly    65 YNF----------------YCSDEGTFGCTFQSQCQVPKRGPFSCQQAGL----FPDPYDCRRYH 109
            .:|                ||.          ::|:            ||    ..||.:|.:|.
  Fly    67 QSFNPSKGSCVDTLANSNKYCG----------NRCE------------GLDGEWVADPTECHKYF 109

  Fly   110 ECSDQSVDTPRICSNGAGYSTLTGTCVLPRESEQCIQEQFTCSRSGQVGGW--APDNRYFYVCVN 172
            .|.: .|....:|..|..:...:.:|:...:| .|:.....|....:...:  ..|..|:|.| :
  Fly   110 YCMN-GVPLAGMCPVGQHFDERSQSCLYGVDS-MCVDVNNICELVAENTKFRNEKDCAYYYEC-D 171

  Fly   173 DTANSLYPLMMKCHEGFVFNSYSCVPDTRSMRSIQAMESHTCMNNDRYQCPFRTSE--------- 228
            .|.|..              |.||.. |...|....:||..|:..::.:|...:.|         
  Fly   172 KTGNHA--------------SKSCTV-TSKKREYFDVESGNCVEANKVECTAHSKENVCTSSTTM 221

  Fly   229 -----------IEYCKCV--DGELEVM--TCPAGFQID--------PKILTCVTDRIYQCSDFEI 270
                       ...||.:  ..:|:.:  .||.|:..|        |..:.|..:|........:
  Fly   222 TFKSDQATCRGYFVCKALYPVADLDPLWTQCPEGYFFDEDRQLCANPTTVVCTHNRCDGRGTMLV 286

  Fly   271 LSCPNVSTKDEYCICIDH-QLQIYSCPMGQYFNAETRKCQSE 311
            .|..|  ....|..|:|: ::...:|....:|:.....|.|:
  Fly   287 TSSSN--NCHNYIRCVDNKEVTEETCHWDHFFDETVEACSSK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 12/53 (23%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 10/42 (24%)
ChtBD2 89..136 CDD:214696 12/59 (20%)
CBM_14 278..332 CDD:279884 9/51 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.