DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32302 and CG6933

DIOPT Version :9

Sequence 1:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001262097.1 Gene:CG6933 / 40214 FlyBaseID:FBgn0036952 Length:363 Species:Drosophila melanogaster


Alignment Length:337 Identity:76/337 - (22%)
Similarity:108/337 - (32%) Gaps:111/337 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PVCLILLALALGSAWAND--------NPCQDVRIPGFVC--MNCTTLGYCIRDATGSWETISMLG 60
            |..|:..|.|....:||.        ..|.:|:.|.:|.  :|||...||  |.||         
  Fly    75 PNGLVFNAQAGSCDYANTTVCSTSAVETCSNVKSPMYVANPLNCTEYAYC--DGTG--------- 128

  Fly    61 CQSEYNFYCSDEGTFGCTFQSQCQVPKRGPFSCQQ--------AGLF-PDPYDCRRYHECSDQSV 116
             |..|. .|...|.:..: .::|   ..|| :|.|        :.:| .||..|..|..|.: ..
  Fly   129 -QISYG-DCGTGGVYSAS-STKC---IWGP-ACPQDTICRFMLSNIFVGDPNQCGNYINCVN-GY 185

  Fly   117 DTPRICSNGAG--YSTLTGTC--------------------VLPRESEQCIQEQFTCSRSGQVGG 159
            .|...||:.|.  |:..||.|                    |....:..|.:|.|..:....|.|
  Fly   186 GTSEKCSSTANPYYNKATGNCQSTNPCTGEDSNSGNSDQFTVGQTNATACDEEAFKAADPLTVNG 250

  Fly   160 WAPDNRY---------FYVCVNDTANSLYPLMMKCHEGFVFNSYSCVPDTRSMRSIQAMESHTCM 215
            .:.|.||         :|.|....|...:   .:|..|..||:..||          :..|..|.
  Fly   251 ESVDYRYVSDGVTCYGYYYCAAVNATGYW---NQCPTGTQFNAGKCV----------SPASFVCT 302

  Fly   216 NNDRYQC-----PFRTSE--IEYCKCVDGELEVMTCPAGFQIDPKILTCVTDRIYQCSDFEILSC 273
            :|   :|     ||...|  ..|..|..|  ...:||.......::....|.:|           
  Fly   303 HN---RCGNVNNPFMADEGCKNYTICSSG--ITGSCPTNAPYYDEVNNICTTKI----------- 351

  Fly   274 PNVSTKDEYCIC 285
                  .:|.||
  Fly   352 ------PDYAIC 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 16/80 (20%)
CG6933NP_001262097.1 ChtBD2 44..90 CDD:214696 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444197
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.