DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32302 and CG7017

DIOPT Version :9

Sequence 1:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster


Alignment Length:272 Identity:60/272 - (22%)
Similarity:93/272 - (34%) Gaps:83/272 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 FPDPYDCRRYHEC-SDQSVDTPRICSNGAGYSTLTGTCVLPRESEQCIQEQFTCSRSGQVGGWAP 162
            |..|..|..:..| |:.||.....|:.|..|:...|.|:|...|..      .|..:..:...|.
  Fly    42 FLRPNTCDNWVRCASNYSVLEQGGCAAGLNYNKELGRCILASSSAA------VCPYADSIADKAT 100

  Fly   163 DNRYFYVCVNDTANSLY--PLMMKCHEGFVFNSYSCVPDTRSMRSIQA---------MESHTCMN 216
            :     :|.|:|..:..  |....| .|::.    |    :|.:.|:|         ..|.:|:.
  Fly   101 N-----LCANETEGAFIVDPSSSDC-RGYIL----C----KSHKQIKANCPNELIFHPVSRSCVY 151

  Fly   217 NDRYQCPF----RTSEI-----------------EYCKCVDGELEVMTCPAGFQIDPKILTCVTD 260
            ..:|:||.    :||..                 :|.:||...|....||.....|..:..||. 
  Fly   152 EKQYRCPISQTKKTSPACRSLPNNTRLADPVHCDQYYECVSEVLHSRACPVASAYDANLGYCVD- 215

  Fly   261 RIYQCSDFEILSCPNVS-----------------TKDEYC----IC-------IDHQLQIYSCPM 297
             :.:.|.:|..:.|...                 ..||.|    ||       .|.:.:..|||:
  Fly   216 -VAEVSCYESAALPEPENTFCLDSATGSARVGYFADDESCSHYYICGSPVAGKHDTEPKHLSCPL 279

  Fly   298 GQYFNAETRKCQ 309
            ||||:.|...|:
  Fly   280 GQYFDFEKLSCR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 14/45 (31%)
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 12/60 (20%)
ChtBD2 246..290 CDD:214696 14/43 (33%)
CBM_14 303..348 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.