DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32302 and CG7290

DIOPT Version :9

Sequence 1:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001262093.1 Gene:CG7290 / 40211 FlyBaseID:FBgn0036949 Length:419 Species:Drosophila melanogaster


Alignment Length:357 Identity:76/357 - (21%)
Similarity:123/357 - (34%) Gaps:92/357 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLALALGSAWANDNPCQDVRIPGFVCMNCTTLGYCIRDATGSW---------------ETISML 59
            ||.|:||..|.|         .|....:|.|.|  |:..:.|::               .:.:.:
  Fly     8 ILAAVALVIACA---------APAIADVNVTAL--CLLVSNGNYVASQSDCSTYYQCQGSSFTAM 61

  Fly    60 GCQSEYNF-----YCSDEGTFGCTFQSQ-CQVPKRGPFSCQQAGLFPDPYDCRRYHECSDQSVDT 118
            .|...|.|     .|:......||..|. |.....|.|:...:       .|..|:.|.......
  Fly    62 SCPQGYYFDKNAQQCTGTVPSTCTSNSDPCLGKAVGSFAASSS-------SCGGYYYCGASGAVR 119

  Fly   119 PRICSNGAGYSTLTGTCVLPRESEQCIQEQFTCSRSGQVGGWAP---------DNRYFYVCVNDT 174
            .. |..|..::..|..||        .:..:.||.|...|....         .|.:::...:|.
  Fly   120 GN-CPAGENFNPTTMACV--------YKNNYPCSESAGDGSTVSVALNLCNLVKNGFYFGSPSDC 175

  Fly   175 A-------NSLYPLMMKCHEGFVFN----------SYSC--VPDTRSMRSIQAMESHTCMNNDRY 220
            :       |.|:  ...|.:|.|||          :.||  |.:..|:..:.|  ..||.::...
  Fly   176 SGWNFCQDNVLH--SGSCEDGLVFNVQASNCGYKMASSCAQVTNDPSLTGVSA--PTTCSSSGAT 236

  Fly   221 QCPFRTSEIEYCKCVDGELEVMTCPAGFQIDPKILTCVTDRIYQCSDFE--------ILSCPNVS 277
            ..  .|:..:|..|..|..::||||:|:..|.....||| |:...:|.:        .::..:.:
  Fly   237 IA--ATACNQYYLCSAGNYQLMTCPSGYYYDTISKACVT-RMEARNDCDRCVGTTATFVNAYSAT 298

  Fly   278 TKDEYCICIDH-QLQIYSCPMGQYFNAETRKC 308
            ...:|..|::. |..:.|||...|||.....|
  Fly   299 NCSDYLYCVNGVQKAVESCPTNYYFNENLGSC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 8/49 (16%)
CG7290NP_001262093.1 CBM_14 32..77 CDD:279884 5/44 (11%)
CBM_14 91..142 CDD:279884 11/66 (17%)
CBM_14 160..207 CDD:279884 9/48 (19%)
CBM_14 234..277 CDD:279884 14/45 (31%)
ChtBD2 <296..331 CDD:214696 10/35 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.