DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32302 and CG7298

DIOPT Version :9

Sequence 1:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster


Alignment Length:329 Identity:66/329 - (20%)
Similarity:104/329 - (31%) Gaps:112/329 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WANDNPC---QDVRIPGFVCMNCTTLG---YCIR-DATGS--------WETISMLGCQSEYNFYC 69
            |..:|||   .:..:|     |....|   ||:. .:.||        ::| :.|.|  .|....
  Fly    88 WGVENPCAGKNNTWVP-----NTAVCGGWFYCLEGKSAGSGNCPVNQKFDT-TTLAC--VYGTCS 144

  Fly    70 SDEGTFGCTFQSQCQVPKRGPFSCQQAGLFPDPYDCRRYHECSDQSVDTPRI-----CS--NGAG 127
            :.:||.....:|.|.|...|.:       |.|...|..:|.|  :|..|..:     ||  |...
  Fly   145 NTQGTNETVLESLCDVVPPGQY-------FGDTESCSTWHYC--ESTSTGLVLQSGKCSANNQTA 200

  Fly   128 YSTLTGTCVLPRESEQCIQEQFTCSRSGQVGGWAPDNRYFYVCVNDTANSLYPLMMKCHEGFVFN 192
            |:.|...|.....|        .|||...:.            ::|.|                 
  Fly   201 YNVLANQCTYESAS--------VCSRVTNIP------------LSDAA----------------- 228

  Fly   193 SYSCVPDTRSMRSIQAMESHTCMNNDRYQCPFRTSEIEYCKCVDGELEVMTCPAGFQIDPKILTC 257
             .||     |....::.:...|..              |..|.:|:.....||.|...|..:..|
  Fly   229 -VSC-----STNGAKSADPKVCGT--------------YYVCTNGKNVATYCPTGDYYDDSLGYC 273

  Fly   258 VTDRI-----------YQCSDF-EILSCPNVSTKDEYCICIDH-QLQIYSCPMGQYFNAETRKCQ 309
            |:.::           |..|.| ..:...|.||   |..|... :..:.:||...:|:...:.|:
  Fly   274 VSRQVATPVAGCNRCQYATSTFVNAVDSNNCST---YYYCNSQGEATLNTCPADTFFDESRQGCK 335

  Fly   310 SESE 313
            |:.:
  Fly   336 SDDD 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 14/56 (25%)
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 8/48 (17%)
ChtBD2 286..334 CDD:214696 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444195
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.