DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32302 and obst-F

DIOPT Version :9

Sequence 1:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:287 Identity:62/287 - (21%)
Similarity:98/287 - (34%) Gaps:84/287 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 QQAGLFPDPYDCRRYHECSDQSVDTPRICSNGAGYSTLTGTCVLPRESEQC-------IQEQFTC 151
            |:..|.|.|.||..|..||  .|.|...|..|..:......|.|| |:..|       ::.....
  Fly    47 QEGDLVPHPLDCNGYFSCS--RVPTLLYCDQGLQFDENRAICDLP-ENTNCRPVATGTVESANGL 108

  Fly   152 SRSGQVGGWAPDNRYFYVCVNDTA-------NSLYPLMMKC-HEGFVFNSYSCVPDTRS-----M 203
            :.:.::..|....:..:|.|:.|:       ....|..::| |.|..|     :|..|:     :
  Fly   109 ADNSELNWWPHKPKPVFVAVDVTSGQPVNPMEKYDPEHIECRHYGAYF-----LPHPRNCGLYFI 168

  Fly   204 RSIQAMESHTC-----MNNDRYQCPFRTSEIEYCKCVDGELEV----------MTCPAG------ 247
            .:...:..|.|     .|.::.:|......|.|     ||.::          |..|..      
  Fly   169 CAYGHLHRHQCGRGTAWNFEKSECQLSDQAICY-----GESQISEPHTDVETTMKVPTANSEGAV 228

  Fly   248 ----------------FQIDPKI--LTCVTDRIYQCSDFEILSCPNVSTKDEY------C----I 284
                            |...|:|  |..||......::...|:||  |||..|      |    |
  Fly   229 TVCYIVGSSEYTTLQQFLTSPEITELPPVTPPSPPRAEANALTCP--STKQSYMSHPEDCSKYYI 291

  Fly   285 CIDHQLQIYSCPMGQYFNAETRKCQSE 311
            ||.....:.|||.|.:::.::..|:.|
  Fly   292 CIGGMPVLTSCPKGLFWDQKSGFCEME 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 17/49 (35%)
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 17/49 (35%)
CBM_14 156..198 CDD:279884 7/46 (15%)
CBM_14 272..321 CDD:279884 16/49 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.