DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32302 and obst-J

DIOPT Version :9

Sequence 1:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_649179.2 Gene:obst-J / 40202 FlyBaseID:FBgn0036940 Length:353 Species:Drosophila melanogaster


Alignment Length:253 Identity:56/253 - (22%)
Similarity:87/253 - (34%) Gaps:73/253 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LFPDPYDCRRYHECSD------QSVDTP---------RICSNGAGYSTLTGTCVLPRESEQCIQE 147
            :.|....|:|::.|:.      |..:.|         .||..||                 |..|
  Fly    38 MLPHKDHCQRFYVCTGDDDMPFQEFNCPAEYHFSKKLMICVPGA-----------------CTDE 85

  Fly   148 QFTCSRSGQVGGWAPDNRYFYVCVNDTANSLYPLMMKCHEGFVFNSYSCVPDTRSMRSIQAMESH 212
            ...|..:..|.....|...:..|:...:.:    :.||..|..|:     |..|:...:....:|
  Fly    86 SVFCGLTNSVERVQSDCTRYRQCLEGGSFA----VAKCSVGNYFD-----PARRACLPVAISAAH 141

  Fly   213 TCM----NNDRYQCPFRTSEIE-YCKCVDGELEVMTCPAGFQIDPKILTCVTDRIYQCSDFEILS 272
            .|.    :|.....|   |:.| |.:|..|:.|::.||:|...|.::.:||.|....|  .|..:
  Fly   142 QCSCVLPDNATLANP---SDCETYFRCHSGQAELVQCPSGDYFDERVSSCVPDHTGIC--LEKPT 201

  Fly   273 CPNVSTK-----DE-----------------YCICIDHQLQIYSCPMGQYFNAETRKC 308
            .|...|:     ||                 |.||...::....||.||||:...|.|
  Fly   202 MPPTLTEQALAMDECIRTGSRLAPHSRDCQRYYICAKKRVLEMRCPRGQYFDVVRRYC 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 10/60 (17%)
obst-JNP_649179.2 ChtBD2 <40..79 CDD:214696 8/38 (21%)
CBM_14 145..192 CDD:279884 14/49 (29%)
CBM_14 216..259 CDD:279884 10/42 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444198
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.