DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32302 and obst-H

DIOPT Version :9

Sequence 1:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster


Alignment Length:299 Identity:67/299 - (22%)
Similarity:102/299 - (34%) Gaps:95/299 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VPVCLILLALALGSAWAND------NPCQDVRIPGFVCMNCTTLGYCIRDATGSWETISMLGCQS 63
            :.:||:||       |::.      :.|..:....||               .|||:     |||
  Fly     6 IHLCLVLL-------WSSRINADHFDECDGMDDGAFV---------------QSWES-----CQS 43

  Fly    64 EYNFYCSDEGTF------GCTFQSQ---CQVPKRGPFSCQQAGLFPDPYDCRRYHECSDQSVDTP 119
              ..||..|.:.      |..|.|:   |.:...  .||     |.|..|     |.||...:|.
  Fly    44 --YVYCEGEESLKGDCEDGEYFDSEAGTCDIAAN--VSC-----FLDEVD-----EPSDPEPETD 94

  Fly   120 RICSNGAGYSTLTGTCVLPRESEQCIQEQFT--------------CSRS---GQVGGWAPDN--R 165
            .      ....:..|   ||.:|..|.|..|              |..|   |||...|.:|  .
  Fly    95 E------EEEEIPAT---PRPTEPPIVETPTEVDIINIAPVVRPNCPISDDPGQVIFMASNNSCT 150

  Fly   166 YFYVCVNDTANSLYPLMMKCHEGFVFNSYS--CVPDTRSMRSIQAMESHTCMNN--DRYQCPFRT 226
            .:|:|.:..|     :.|.|.....|||.:  |....:...:.:...||.|:.:  :.:..|...
  Fly   151 NYYLCYHGHA-----MEMHCDNELYFNSLTGQCDYPDKVQCAFEDPRSHKCLPHMTEFFPHPDNC 210

  Fly   227 SEIEYCKCVDGELEVMTCPAGFQIDPKILTCVTDRIYQC 265
            :...|  |:.|.|.:..||..:..|.:..:||...:.:|
  Fly   211 NYFYY--CIKGFLTLQQCPFYYGWDIERRSCVQIGVAKC 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 11/49 (22%)
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 16/74 (22%)
CBM_14 142..184 CDD:279884 11/46 (24%)
ChtBD2 203..240 CDD:214696 8/38 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.