DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32302 and CG10140

DIOPT Version :9

Sequence 1:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster


Alignment Length:320 Identity:64/320 - (20%)
Similarity:115/320 - (35%) Gaps:82/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FVCMNCTTLGYCIRDATGSWETISMLGCQS-----EYNFYCSDEGTFGCTFQSQCQVPKRGPFSC 93
            |:|:.|...|...:|...|..|.|.|...|     ||.....:....|               :.
  Fly     9 FICIFCGVFGARPKDLDVSGTTDSTLETDSTTSGLEYGLITGNLSICG---------------NV 58

  Fly    94 QQAGLFPDPYDCRRYHEC-SDQSVDTPRICSNGAGYSTLTGTCVLPRESEQCI-----------Q 146
            ......|...||.||:.| |.|:::..  |.....::..|.:||.|.::: |:           .
  Fly    59 ADNVFLPFVGDCNRYYLCRSGQAIELQ--CEWPYEFNANTQSCVHPGDAD-CLPTCEAFNFSTFS 120

  Fly   147 EQFTCSRSGQVGGWAPDNRYFYVCVNDTANSLYPLMMKCHEGFVFNSYSCVPDTRSMRSIQAMES 211
            .|.||:|             :.:|....     |::.:|.:|..:||.:...|  ..:::..:||
  Fly   121 YQRTCTR-------------YVLCYYGK-----PVLRQCQDGLQYNSATDRCD--FPQNVDCVES 165

  Fly   212 HTCMNNDRYQCPFRTSEI---EYCKCVDGELEVMTCPAGFQIDPKILTC------------VTDR 261
            ...:.::.|...:..|::   :|..|.:|.....||.||.....|...|            |..:
  Fly   166 ECSIYSNAYHLRYVPSKVSCQKYFICGNGIPREQTCTAGLHFSTKCDCCDIPSKSDCQIPAVERK 230

  Fly   262 IYQCSDFEILS----CP--------NVSTKDEYCICIDHQLQIYSCPMGQYFNAETRKCQ 309
            :.|.|....::    ||        :.|.:|.|..|:|....:..|..|.:::...::|:
  Fly   231 VQQLSRLSPVTTVGICPPSGVHFYVHESRRDAYYYCVDGHGLVLDCSAGLWYDPTVQECR 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 13/50 (26%)
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 13/44 (30%)
CBM_14 111..161 CDD:279884 11/69 (16%)
CBM_14 178..222 CDD:279884 10/43 (23%)
CBM_14 246..295 CDD:279884 10/45 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466399
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.